KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0812Help
Entry
Oant_0812         CDS       T00568                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Oant_0812 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oant_0812 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oant_0812 (trpA)
Enzymes [BR:oan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oant_0812 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:840354..841193
Genome map
AA seq 279 aa AA seqDB search
MTTRIDTKFAELKAEGRPALVTYFMGGDPDLETSLKVMKALPKAGADVIELGMPFSDPMA
DGPAIQAAGLRALNAGQTLAKTLHMAAEFRKEDNTTPIVMMGYYNPIYIYGVERFLADAK
ASGVDGLIVVDLPSEMDAELCIPAMKAGINFIRLTTPTTDDKRLPKVLHNSSGFVYYVSM
NGITGSAIADTAKVGEAVRHIKKSTDLPICVGFGVKTPEQAAAIATHADGVVVGTAIVNA
IAGELDENGKAKGDPVAAATRLVHALAESVRATRLEAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcatcgacaccaaattcgctgaactgaaggccgagggccgtccggcgctc
gttacctatttcatgggtggcgatcccgatctggaaacctcgctcaaggtgatgaaggcc
ttgccaaaggctggtgccgacgtgatcgaactcggtatgcccttctccgatccgatggca
gacggacccgccattcaggccgctggcctgcgcgccctcaacgccggtcagacgcttgcc
aagacgttgcacatggcagcagaattccgcaaggaagacaacacgaccccgatcgtcatg
atgggctattacaacccgatctatatttacggcgtggaacgctttctggccgatgccaag
gcttccggcgtggacgggctgatcgtcgtcgatcttccgtctgaaatggatgctgagctt
tgcattccggccatgaaggcgggtatcaattttatccgcctcaccacgccaaccacggac
gacaagcgcttgccgaaggtgctgcataattcatcgggcttcgtctattacgtctcgatg
aacggcatcaccggttcggccattgccgatacggcaaaggtcggtgaagctgtgcgtcac
atcaagaagagcaccgatctgccgatctgtgtcggtttcggcgtcaagacaccggagcag
gcagcagccatcgccacccatgccgatggcgtcgtcgtcggcacggcgattgtcaacgcg
attgccggtgaactggacgaaaacggcaaggcgaagggcgatcctgtcgccgctgcaacc
agacttgtccacgcccttgcggagagtgtgcgtgccacacgccttgaagccgcccaataa

DBGET integrated database retrieval system