KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0812Help
Entry
Oant_0812         CDS       T00568                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00260  Glycine, serine and threonine metabolism
oan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01130  Biosynthesis of antibiotics
oan01230  Biosynthesis of amino acids
Module
oan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oant_0812
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oant_0812
Enzymes [BR:oan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Oant_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG DUF561
Motif
Other DBs
NCBI-ProteinID: ABS13534
JGI: Oant0812
UniProt: A6WX30
Position
1:840354..841193
Genome map
AA seq 279 aa AA seqDB search
MTTRIDTKFAELKAEGRPALVTYFMGGDPDLETSLKVMKALPKAGADVIELGMPFSDPMA
DGPAIQAAGLRALNAGQTLAKTLHMAAEFRKEDNTTPIVMMGYYNPIYIYGVERFLADAK
ASGVDGLIVVDLPSEMDAELCIPAMKAGINFIRLTTPTTDDKRLPKVLHNSSGFVYYVSM
NGITGSAIADTAKVGEAVRHIKKSTDLPICVGFGVKTPEQAAAIATHADGVVVGTAIVNA
IAGELDENGKAKGDPVAAATRLVHALAESVRATRLEAAQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcatcgacaccaaattcgctgaactgaaggccgagggccgtccggcgctc
gttacctatttcatgggtggcgatcccgatctggaaacctcgctcaaggtgatgaaggcc
ttgccaaaggctggtgccgacgtgatcgaactcggtatgcccttctccgatccgatggca
gacggacccgccattcaggccgctggcctgcgcgccctcaacgccggtcagacgcttgcc
aagacgttgcacatggcagcagaattccgcaaggaagacaacacgaccccgatcgtcatg
atgggctattacaacccgatctatatttacggcgtggaacgctttctggccgatgccaag
gcttccggcgtggacgggctgatcgtcgtcgatcttccgtctgaaatggatgctgagctt
tgcattccggccatgaaggcgggtatcaattttatccgcctcaccacgccaaccacggac
gacaagcgcttgccgaaggtgctgcataattcatcgggcttcgtctattacgtctcgatg
aacggcatcaccggttcggccattgccgatacggcaaaggtcggtgaagctgtgcgtcac
atcaagaagagcaccgatctgccgatctgtgtcggtttcggcgtcaagacaccggagcag
gcagcagccatcgccacccatgccgatggcgtcgtcgtcggcacggcgattgtcaacgcg
attgccggtgaactggacgaaaacggcaaggcgaagggcgatcctgtcgccgctgcaacc
agacttgtccacgcccttgcggagagtgtgcgtgccacacgccttgaagccgcccaataa

DBGET integrated database retrieval system