KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0934Help
Entry
Oant_0934         CDS       T00568                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_0934
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oant_0934
  Amino acid metabolism
   00310 Lysine degradation
    Oant_0934
Enzymes [BR:oan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Oant_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:972866..974095
Genome map
AA seq 409 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKVGDAIAIDEPLVELETDKVTVEVPAAAAGVLAEIT
AKEGDTVEVNALLGQISTDGAAVAAAPAAKKEEAKPAAAPAAAPVASASSGPAMQPAPAA
SKLLAENNLSADQVDGSGKRGQVLKGDVLDAIAKGVSAAPAPAAPAAARPASSADDASRE
ERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMSAVMELRTKYKDVFEKKHGVKLGFMG
FFTKAVTHALKEIPAVNAEIDGTDIIYKNFAHVGMAVGTDKGLVVPVIRDADQLSIAGVE
KELGRLAKAARDGTLSVADMQGGTFTITNGGVYGSLMSSPILNAPQSGILGMHKIQERPV
VVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaaattcgcgttcccacgcttggggagtccgttactgaggcaaccatcgga
aaatggttcaagaaggtcggcgacgccatcgccatcgatgaaccgctggtggaactggaa
accgacaaggtgacagtggaagttccggctgctgctgctggcgtattggctgaaatcacg
gccaaggaaggcgacactgtcgaggtcaatgcgcttctcggccagatttccaccgatggc
gctgccgtcgctgcggctcctgctgcgaagaaggaagaagccaagcctgctgccgcaccg
gcagcggcacctgtcgcttcggcttcgtcgggcccggctatgcagcctgccccggctgcc
tccaagctgcttgctgaaaataacctctccgccgatcaggtggacggttccggcaagcgc
ggtcaggtgctgaagggcgacgtgctcgacgctatcgccaagggtgtttccgctgctccg
gctccggccgcaccggccgctgcccgtccggcatcgtcggctgacgacgcatcgcgcgaa
gaacgcgtgaagatgacccgtctgcgccagaccatcgccaagcgtctgaaggatgcccag
aacaccgccgccatgctgacgacctataacgaagtcgacatgtctgcggtcatggaactg
cgcaccaagtacaaggacgtcttcgagaagaagcatggcgtgaagctcggcttcatgggc
ttcttcaccaaggccgtgacccatgcgctgaaggaaatcccggctgttaacgccgagatc
gacggcacggacatcatttacaagaacttcgcccatgtcggcatggccgtcggcacggac
aagggccttgtggttccggtcatccgtgacgccgaccagctttcgattgcaggcgttgaa
aaggaactgggacgtcttgccaaggcagcacgcgacggtacgctttcggtcgctgacatg
cagggcggcacgttcaccatcaccaatggcggcgtgtacggttcgctgatgtcctcgccg
atcctgaacgctccgcagtcgggtatccttggcatgcacaagatccaggaacgtccggtt
gtcgtcggcggtcagatcgtgatccgtccgatgatgtatcttgccctgtcctacgatcac
cgcatcgtggacggcaaggaagccgtgaccttcctcgtgcgcgtcaaggaaagcctggaa
gatccggaacgtctggttctcgatctctaa

DBGET integrated database retrieval system