KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0952Help
Entry
Oant_0952         CDS       T00568                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_0952
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oant_0952
   00650 Butanoate metabolism
    Oant_0952
  Energy metabolism
   00190 Oxidative phosphorylation
    Oant_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:987555..987950
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRTPLGKVRGLGSAKEGTGHFWYQRLSAAALVPLVMFFIGLVISLNGASYAEV
RAALSHPFTAIVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKVVLVMLNTFFTAVVGFAC
IFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtatgaacaatgatatgcgcaccccgctcggcaaggttcggggtctgggatca
gccaaggaaggcaccggtcatttctggtatcagcgcttgagcgccgccgctcttgtgccg
ctggtcatgtttttcatcggtctggtcatttcgctcaatggcgcaagctatgcggaagtc
cgggctgccctgtcgcatcccttcacggcaatcgtgatggcgctgttcgttctgactggc
gtttatcacatgcgcctgggtatgcaggtcattatcgaagattatgtgcatggcgaaggc
atgaaggtcgtgctggtgatgttgaacaccttctttacggcggtggtcggcttcgcctgc
atttttgcgattctcaagctgagcttcggaggttga

DBGET integrated database retrieval system