KEGG   Ochrobactrum anthropi ATCC 49188: Oant_0976Help
Entry
Oant_0976         CDS       T00568                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Oant_0976
Enzymes [BR:oan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Oant_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1012535..1013269
Genome map
AA seq 244 aa AA seqDB search
MAGPAQIASLGRVLVTRPQPAGSETAAKLASRGYEPVLLPLSRTVALSFALPDGPFAALT
VTSANAFHHIDTERLKPFLGLPLFAVGQGTAQAAQKAGFGHVIDGGGDAVRLAATMRRDL
PEQSRVLYLAGRVRQPVFEDEIQAAKLDMHVADVYDTETIPYSASALRNVLDGAPFVAVM
LYSGVAATSFVEAMHEIAPPFDEKTRFLCISARVADRLPSLWRANALVADHPDEGGLFRL
FAKL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttggcggggccagcacaaatcgcatctcttggtcgcgttctggtgacgcggccacagccg
gctggctccgaaaccgccgccaaactggcgtcgaggggctatgagccggttctccttcca
ctgagccgaaccgttgcgctttcctttgctctgcccgatggcccgtttgcggctttgaca
gtgacgagcgccaatgcctttcaccatatcgacacggagcggctgaagccgtttcttggc
ctgccgctctttgctgtgggacagggaacagcgcaggcagcgcagaaggccgggttcggt
catgtgatcgacgggggcggtgatgcggttcgtcttgcagcgacgatgcggcgcgatctt
cccgaacaatcccgtgttctttatctcgccggacgggtgcgccaaccggtgttcgaggac
gagatacaggccgccaaactcgatatgcatgttgccgatgtctatgacacggagacaatt
ccttattctgcgtcagcacttcggaatgtgcttgacggcgcgccttttgtcgcggtcatg
ctctattccggcgttgccgcgacgagcttcgtcgaagcgatgcatgaaatcgcgccgcct
tttgacgagaaaacgcggtttttatgcatttctgcccgtgtggccgaccggttgccgtcg
ctctggcgggcaaatgcgcttgtcgcagaccacccggatgaaggcggacttttccggctg
tttgccaaactttga

DBGET integrated database retrieval system