KEGG   Ochrobactrum anthropi: Oant_1077Help
Entry
Oant_1077         CDS       T00568                                 

Definition
signal recognition particle protein
Orthology
K03106  
signal recognition particle subunit SRP54
Organism
oan  Ochrobactrum anthropi
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:oan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Oant_1077
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Oant_1077
Secretion system [BR:oan02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   Oant_1077
  Eukaryotic Sec-SRP protein
   Oant_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1121494..1123065
Genome map
AA seq 523 aa AA seqDB search
MFESLQERLGSILNGLTGRGALSEADVAAALREVRRALIEADVSLEVVRSFTDRVREKAV
GAEILKSIKPGQMVVKIVHDELIEMLGTEGVAIDLNAPAPVVIMMVGLQGSGKTTTTGKI
AKRLTERQRKKVLMASLDTRRPAAQEQLRQLGIQTSVDTLPIIAGQSPVEIAKRAVQAAK
LGAHDVVILDTAGRTHIDEPLMVEMADIRKAANPHEILLVADSLTGQDAVNLARNFDERV
GITGIVLTRMDGDGRGGAALSMRAITGKPIKLIATGEKMDALEEFYPKRIADRILGMGDI
VSLVEKAAENIDAEKAAAMAKKMQSGKFDLNDLADQLGQMKKLGGMGSIMGMMPGMGGMK
DKAAAAGLDDKVFDRQLAIIGSMTKAERANPDLLKHSRKQRIAKGSGTTAADINKLLKMH
RQMADMMKVMGKGKGGMMKQMMGGLANKMGLGGLGGGMGGLGGMPDLSKMDPKQLEALAK
QAEAAGLTKGGGLPGLPGGGLPGLGGPKLPGLGGGLPGLPKKK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatcacttcaggagcgtcttggctccatcctgaacggccttaccggacgcggc
gctctttctgaagccgacgtggccgcggcgttgcgcgaagtgcgtcgcgcgctgatcgag
gctgatgtttcgctggaagtggttcgctccttcaccgaccgcgttcgtgagaaggccgtc
ggcgcagagattctgaaaagcatcaagcccggccagatggtcgtcaagatcgtccatgac
gagcttatcgagatgcttggcaccgaaggtgtcgcaattgacctgaacgcgcctgcacct
gtcgtcatcatgatggtcggtctgcaggggtcgggcaagacgaccaccaccggcaagatc
gccaagcgtttgacggagcgccagcgcaagaaggtgttgatggcgtcgctcgatacgcgc
cgtcctgccgcacaggaacagcttcgccagctcggtattcagaccagtgtcgacacgctg
ccgatcatcgccggccagtcgccggtcgaaatcgccaagcgcgccgtacaggctgcaaag
cttggcgcacacgatgtcgtcattctcgataccgcaggccgcacgcatattgacgagccg
ctgatggtggaaatggcggatatccgcaaggccgccaatccgcacgaaatcctgctcgtc
gccgacagcctgaccggtcaggatgcagtcaatctggcgcgcaatttcgacgagcgcgtt
ggcattacgggtatcgttctcacccgtatggatggcgatggccgtggcggtgcagcgctt
tcgatgcgtgccatcaccggcaagccgatcaagctgatcgccaccggcgaaaagatggat
gcgcttgaggaattctatccgaagcgtatcgccgaccgtattctcggcatgggcgacatt
gtttcgctcgtggaaaaagctgccgaaaacatcgacgcggaaaaagccgcggcgatggcc
aagaagatgcagtcgggcaagtttgatctcaatgatcttgccgatcagctgggccagatg
aaaaagctcggcggcatgggcagcatcatgggcatgatgcccggcatgggcggaatgaag
gacaaggcagcagcagctggtctcgacgacaaggtgttcgaccgccagctcgccatcatc
ggctcgatgaccaaggccgagcgcgccaatcccgaccttctcaagcacagccgcaagcag
cgcattgccaagggttccggcacgactgctgccgacatcaacaagcttctcaagatgcac
cgccagatggccgacatgatgaaagtcatgggcaagggcaagggcggaatgatgaagcag
atgatgggcggccttgccaacaagatgggccttggtggtctcggtggcggtatgggcggc
cttggtggcatgcctgatctctcgaagatggaccccaagcagcttgaagcgcttgccaag
caggcggaagcagccggtctgacgaaaggcggcggtttgccgggccttccgggcggtggt
cttccgggcttgggtggaccgaaacttcccggtcttggtggcggccttccaggtctgccg
aagaagaagtga

DBGET integrated database retrieval system