KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1077Help
Entry
Oant_1077         CDS       T00568                                 

Definition
(GenBank) signal recognition particle protein
  KO
K03106  
signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:oan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Oant_1077
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Oant_1077
Enzymes [BR:oan01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     Oant_1077
Secretion system [BR:oan02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   Oant_1077
  Eukaryotic Sec-SRP protein
   Oant_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:1121494..1123065
Genome map
AA seq 523 aa AA seqDB search
MFESLQERLGSILNGLTGRGALSEADVAAALREVRRALIEADVSLEVVRSFTDRVREKAV
GAEILKSIKPGQMVVKIVHDELIEMLGTEGVAIDLNAPAPVVIMMVGLQGSGKTTTTGKI
AKRLTERQRKKVLMASLDTRRPAAQEQLRQLGIQTSVDTLPIIAGQSPVEIAKRAVQAAK
LGAHDVVILDTAGRTHIDEPLMVEMADIRKAANPHEILLVADSLTGQDAVNLARNFDERV
GITGIVLTRMDGDGRGGAALSMRAITGKPIKLIATGEKMDALEEFYPKRIADRILGMGDI
VSLVEKAAENIDAEKAAAMAKKMQSGKFDLNDLADQLGQMKKLGGMGSIMGMMPGMGGMK
DKAAAAGLDDKVFDRQLAIIGSMTKAERANPDLLKHSRKQRIAKGSGTTAADINKLLKMH
RQMADMMKVMGKGKGGMMKQMMGGLANKMGLGGLGGGMGGLGGMPDLSKMDPKQLEALAK
QAEAAGLTKGGGLPGLPGGGLPGLGGPKLPGLGGGLPGLPKKK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatcacttcaggagcgtcttggctccatcctgaacggccttaccggacgcggc
gctctttctgaagccgacgtggccgcggcgttgcgcgaagtgcgtcgcgcgctgatcgag
gctgatgtttcgctggaagtggttcgctccttcaccgaccgcgttcgtgagaaggccgtc
ggcgcagagattctgaaaagcatcaagcccggccagatggtcgtcaagatcgtccatgac
gagcttatcgagatgcttggcaccgaaggtgtcgcaattgacctgaacgcgcctgcacct
gtcgtcatcatgatggtcggtctgcaggggtcgggcaagacgaccaccaccggcaagatc
gccaagcgtttgacggagcgccagcgcaagaaggtgttgatggcgtcgctcgatacgcgc
cgtcctgccgcacaggaacagcttcgccagctcggtattcagaccagtgtcgacacgctg
ccgatcatcgccggccagtcgccggtcgaaatcgccaagcgcgccgtacaggctgcaaag
cttggcgcacacgatgtcgtcattctcgataccgcaggccgcacgcatattgacgagccg
ctgatggtggaaatggcggatatccgcaaggccgccaatccgcacgaaatcctgctcgtc
gccgacagcctgaccggtcaggatgcagtcaatctggcgcgcaatttcgacgagcgcgtt
ggcattacgggtatcgttctcacccgtatggatggcgatggccgtggcggtgcagcgctt
tcgatgcgtgccatcaccggcaagccgatcaagctgatcgccaccggcgaaaagatggat
gcgcttgaggaattctatccgaagcgtatcgccgaccgtattctcggcatgggcgacatt
gtttcgctcgtggaaaaagctgccgaaaacatcgacgcggaaaaagccgcggcgatggcc
aagaagatgcagtcgggcaagtttgatctcaatgatcttgccgatcagctgggccagatg
aaaaagctcggcggcatgggcagcatcatgggcatgatgcccggcatgggcggaatgaag
gacaaggcagcagcagctggtctcgacgacaaggtgttcgaccgccagctcgccatcatc
ggctcgatgaccaaggccgagcgcgccaatcccgaccttctcaagcacagccgcaagcag
cgcattgccaagggttccggcacgactgctgccgacatcaacaagcttctcaagatgcac
cgccagatggccgacatgatgaaagtcatgggcaagggcaagggcggaatgatgaagcag
atgatgggcggccttgccaacaagatgggccttggtggtctcggtggcggtatgggcggc
cttggtggcatgcctgatctctcgaagatggaccccaagcagcttgaagcgcttgccaag
caggcggaagcagccggtctgacgaaaggcggcggtttgccgggccttccgggcggtggt
cttccgggcttgggtggaccgaaacttcccggtcttggtggcggccttccaggtctgccg
aagaagaagtga

DBGET integrated database retrieval system