KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1269Help
Entry
Oant_1269         CDS       T00568                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_1269
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Oant_1269
   00630 Glyoxylate and dicarboxylate metabolism
    Oant_1269
Enzymes [BR:oan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Oant_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1336923..1339109)
Genome map
AA seq 728 aa AA seqDB search
MVSQKAGNYVEIEGLRVAPELVEFLAKEAAPGTGVEPEKFWKGFAAIIRDLAPKNRALLA
KRDDLQAKIDAWYKQNRDKGYSQADYQQFLKNIGYLLPEGGEFSVSTTNVDPEITHIAGP
QLVVPVMNARYALNAANARWGSLYDALYGTDAISDADGGEKGKGYNPKRGEKVIAWAKNF
LDESAPLATGNWANVAGLAVKDGKLEIKLTDGSATALKDANQFKGYNGDAAAPTNVLLAK
NNMHVDIVVNADHPIGKTDPAHIADVVLESAVSTIQDCEDSIAAVDAEDKVAVYRNWLGL
MNGKLEDTFEKNGKQMTRRLNGDRSYKAADGSTLSLKGRSLMLVRNVGHLMTNPAIIDAD
GHEVPEGIMDAAFTSLIALHDIGPNGRHMNSREGSVYIVKPKMHGPEEVAFANEIFTRTE
EMLGMKPNTLKIGIMDEERRTTVNLKEAIRAAKERVVFINTGFLDRTGDEIHTSMEAGPM
IRKGDMKQAAWIGAYEQWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGA
NTAWVPSPTAATLHATHYHQVDVAAVQAKLKSRPRAKLDDILSVPVATRPNWTPEDIQHE
IDNNAQGILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHIANWLYHGVVSEAQ
VMETMKRMAAVVDKQNEGDALYRPMAADFDKSIAFQAACDLVFKGREQPNGYTEPVLHRR
RLELKAQG
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcagaaagccggtaattacgttgagatagaaggcttgcgcgttgcccctgaa
ctggtggaatttctggccaaggaagctgctcctggaaccggtgtggagccggaaaagttc
tggaagggctttgccgccatcatccgcgatctcgcaccgaagaaccgcgccctccttgcc
aagcgtgacgacctgcaggccaagatcgatgcctggtacaagcagaaccgcgacaagggc
tacagccaggccgattaccagcagttcctgaagaacatcggctatctcctgccggaaggc
ggagagttctcggtttcgaccaccaatgtcgatccggaaatcacccatatcgctggcccg
cagcttgtcgttccggtgatgaatgcccgctacgcgctcaacgccgctaatgcgcgctgg
ggttcgctctatgatgcgctctacggcaccgacgcgatttccgatgccgacggcggggaa
aagggcaagggctacaatccgaagcgtggcgaaaaggtcatcgcctgggcgaaaaacttc
ctcgatgaaagcgcaccgcttgccaccggcaactgggccaatgtcgccggtctcgccgtc
aaggacggcaaacttgaaatcaagctgaccgacggttcggcaacggcgctcaaggatgcc
aaccagttcaagggttataatggcgacgcagccgccccgaccaatgtactgctggccaag
aacaacatgcatgtcgacatcgtcgtcaatgcggaccatccgatcggcaagaccgacccg
gcccatattgccgatgtggttctggaatctgccgtcagcacgattcaagattgcgaagat
tcgattgctgccgtcgatgccgaagacaaggttgcggtttatcgcaactggctcggcctg
atgaacggcaagctggaagacacgttcgagaagaacggcaagcagatgacccgccgcctc
aatggcgaccgcagctacaaggctgcggacggttccacgctgtcgctcaagggccgctcc
ctgatgctggtgcgcaatgtcggccacctcatgaccaatccggcaatcattgatgccgac
ggccatgaagtgccggaaggtatcatggatgcagccttcaccagcctgatcgcgctgcac
gatatcggccccaatggtcgccacatgaattcgcgcgaaggctcggtctatatcgtaaag
ccgaagatgcacggcccggaagaagtggctttcgccaacgaaatcttcacccgtaccgaa
gaaatgctcggcatgaagccgaacacgcttaaaatcggcatcatggacgaggaacgccgc
accacggttaacctcaaggaagcgatccgcgccgccaaggaacgtgtcgtcttcatcaat
accggcttccttgaccgcaccggcgacgagatccatacctcgatggaagcaggcccgatg
atccgcaagggcgatatgaagcaggccgcttggatcggtgcttacgaacagtggaatgtc
gatatcggtctcgaatgcggcctttccggccatgcgcagattggcaagggcatgtgggcc
atgccggacctgatggcagccatgctggaacagaaaatcgcccatccgaaggccggagcg
aataccgcatgggtgccgtcgccgaccgctgccacccttcacgcgacccactatcatcag
gtggatgttgctgccgttcaggcaaagctgaagagccgtccgcgcgccaagctcgacgac
attctgtcggtgccggtcgcaacccgcccgaactggacgccggaagatatccagcacgaa
atcgacaataacgcgcaaggcattctgggctacgtcgtgcgctgggtcgatcagggcgtt
ggctgctcgaaggttccggacatcaacaatgtcggcctgatggaagaccgcgcaacgctg
cgcatctccgcacagcacatcgccaactggctctatcatggcgtcgtttcggaagcccaa
gtgatggaaaccatgaagcgcatggcagccgtcgtcgacaagcagaacgaaggcgatgcc
ctctaccgcccgatggccgctgacttcgacaagtcgattgccttccaggccgcatgcgat
ctggtcttcaagggccgcgagcagccgaacggctacaccgagccagtcctgcatcgccgc
cgtttggaactgaaagctcaagggtga

DBGET integrated database retrieval system