KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1332Help
Entry
Oant_1332         CDS       T00568                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_1332 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_1332 (glk)
   00052 Galactose metabolism
    Oant_1332 (glk)
   00500 Starch and sucrose metabolism
    Oant_1332 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Oant_1332 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Oant_1332 (glk)
   00524 Butirosin and neomycin biosynthesis
    Oant_1332 (glk)
Enzymes [BR:oan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Oant_1332 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1409899..1410939)
Genome map
AA seq 346 aa AA seqDB search
MHENKEIELVEQGFRFPVLVGDIGGTNARFAILVDSNAEPKEFPVLQTADYATIDEAIQS
AILDHTSIRPRSAILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQAL
AVVSLGSDHLEQIGGKPEEVIATRVVLGPGTGLGVAGLVRTRHAWVPVPGEGGHIDIGPR
TERDYQVFPHIERIDGRVAGEQILCGRGLRNLYLAICAADKVTPTLETPADITSAGLDGS
NAQAEETLHLFVTYLGRVAGDLALIFMAHGGVYLSGGIPQRILSALKSGAFREAFEDKAP
HKAIMRDIPVRVITHQLAALTGLSAFAQAPARFEVSTEGRRWRIRA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaacaaagagatagagctggtcgaacaaggtttccggtttccagtactcgtc
ggcgatatcggcggcaccaatgcccgctttgctatcctggtggattccaatgcagagccg
aaggaatttcccgttctccagacggcggattatgcaaccatcgatgaggcgatacagagc
gccattcttgatcacacttcgatccggccacgctccgcaattctcgccgtggccggtccc
gtcgacggtgacgaaatcgacctcaccaattgcgactgggtcgtgcgtccgaagaagatg
atcgccgatctcggtttcgaggacgtgaccgtactgaacgatttcgaggcgcaggcgctt
gccgtcgtgtctctcggcagcgatcatctggaacagattggcggcaagccggaagaagtg
attgccacccgcgtcgtactcggaccgggcacggggcttggcgttgccggtcttgtccgc
acacgccatgcatgggtgccggtgcctggcgaaggcggccatatcgatatcggcccacgc
actgaacgcgattatcaggtcttcccgcatatcgaacgcatcgacggccgcgtcgctggc
gaacagatcctgtgcggccgcggcctgcgcaatctctatcttgccatatgtgccgccgac
aaggtgacgccaacgctggaaacacctgccgacatcacttcagcagggctcgatggcagc
aatgcgcaggcggaagaaaccctgcatctgttcgtcacctatctcggacgcgttgcaggc
gatctggcgctgatcttcatggcgcatggcggtgtctatctttccggcggcattccgcag
cgcatcctttctgcgctcaagtccggcgcttttcgcgaagcattcgaagacaaagccccg
cacaaggccatcatgcgcgacattcctgtccgcgtgatcacgcaccagcttgcagccctc
acagggctttccgcctttgcgcaggcccccgcccgtttcgaagtttcgaccgaaggacgc
cgctggcgcattagagcatga

DBGET integrated database retrieval system