KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1332Help
Entry
Oant_1332         CDS       T00568                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00010  Glycolysis / Gluconeogenesis
oan00052  Galactose metabolism
oan00500  Starch and sucrose metabolism
oan00520  Amino sugar and nucleotide sugar metabolism
oan00521  Streptomycin biosynthesis
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01200  Carbon metabolism
Module
oan_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_1332
   00052 Galactose metabolism
    Oant_1332
   00500 Starch and sucrose metabolism
    Oant_1332
   00520 Amino sugar and nucleotide sugar metabolism
    Oant_1332
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Oant_1332
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Oant_1332
Enzymes [BR:oan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Oant_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABS14049
JGI: Oant1332
UniProt: A6WYJ5
Position
1:complement(1409899..1410939)
Genome map
AA seq 346 aa AA seqDB search
MHENKEIELVEQGFRFPVLVGDIGGTNARFAILVDSNAEPKEFPVLQTADYATIDEAIQS
AILDHTSIRPRSAILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQAL
AVVSLGSDHLEQIGGKPEEVIATRVVLGPGTGLGVAGLVRTRHAWVPVPGEGGHIDIGPR
TERDYQVFPHIERIDGRVAGEQILCGRGLRNLYLAICAADKVTPTLETPADITSAGLDGS
NAQAEETLHLFVTYLGRVAGDLALIFMAHGGVYLSGGIPQRILSALKSGAFREAFEDKAP
HKAIMRDIPVRVITHQLAALTGLSAFAQAPARFEVSTEGRRWRIRA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaacaaagagatagagctggtcgaacaaggtttccggtttccagtactcgtc
ggcgatatcggcggcaccaatgcccgctttgctatcctggtggattccaatgcagagccg
aaggaatttcccgttctccagacggcggattatgcaaccatcgatgaggcgatacagagc
gccattcttgatcacacttcgatccggccacgctccgcaattctcgccgtggccggtccc
gtcgacggtgacgaaatcgacctcaccaattgcgactgggtcgtgcgtccgaagaagatg
atcgccgatctcggtttcgaggacgtgaccgtactgaacgatttcgaggcgcaggcgctt
gccgtcgtgtctctcggcagcgatcatctggaacagattggcggcaagccggaagaagtg
attgccacccgcgtcgtactcggaccgggcacggggcttggcgttgccggtcttgtccgc
acacgccatgcatgggtgccggtgcctggcgaaggcggccatatcgatatcggcccacgc
actgaacgcgattatcaggtcttcccgcatatcgaacgcatcgacggccgcgtcgctggc
gaacagatcctgtgcggccgcggcctgcgcaatctctatcttgccatatgtgccgccgac
aaggtgacgccaacgctggaaacacctgccgacatcacttcagcagggctcgatggcagc
aatgcgcaggcggaagaaaccctgcatctgttcgtcacctatctcggacgcgttgcaggc
gatctggcgctgatcttcatggcgcatggcggtgtctatctttccggcggcattccgcag
cgcatcctttctgcgctcaagtccggcgcttttcgcgaagcattcgaagacaaagccccg
cacaaggccatcatgcgcgacattcctgtccgcgtgatcacgcaccagcttgcagccctc
acagggctttccgcctttgcgcaggcccccgcccgtttcgaagtttcgaccgaaggacgc
cgctggcgcattagagcatga

DBGET integrated database retrieval system