KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1350Help
Entry
Oant_1350         CDS       T00568                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00300  Lysine biosynthesis
oan01100  Metabolic pathways
oan01120  Microbial metabolism in diverse environments
oan01230  Biosynthesis of amino acids
Module
oan_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Oant_1350
Enzymes [BR:oan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Oant_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABS14067
JGI: Oant1350
UniProt: A6WYL3
Position
1:complement(1428600..1429787)
Genome map
AA seq 395 aa AA seqDB search
MSLAVNPADNLAALIRCASVTPAEGGALTALEAMLKPMGFSVERPVFHDEDTPDIENLYA
RKSGNGPHLMFAGHTDVVPPGNEGDWKHPPFSAAIEDGVMYGRGAVDMKGGVACFVAAVA
RHIEKHGSIKGSVSFLITGDEEGPAINGTVKLLDWAKQRGESWDASIVGEPSNPNALGDA
IKIGRRGSLSGTITVHGVQGHAAYPHLAENPVRGITTLVDSLLYPAFDQGTANFQASNLE
VTSIDVGNKATNVIANKATASFNIRFNDTWTAETLQAEIIARLEKAARDNRLRPGRETPI
KYELTWREHPSHVFLTRDEKLIGTLTDSVEAVTGKRPELSTSGGTSDARFIKDYCPVVEF
GLVGQTMHMVDERVALADLEGLTQIYERFIADFFG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagccgtcaatcccgccgataaccttgccgccctcatccgttgtgcatccgta
acgcctgccgagggcggtgcgctgacggcgctggaagcgatgttgaagccgatggggttt
tcggtggaacgacctgtcttccacgatgaagacacgcccgacatcgaaaacctttatgca
cgcaagtcgggcaatggcccgcatctgatgtttgcgggacataccgatgtcgtgcctccc
ggcaatgagggcgactggaaacacccgcccttttctgccgctattgaagacggcgtgatg
tacggtcgcggtgcggttgacatgaagggcggtgttgcctgtttcgtggccgcagttgcc
cgtcacatcgaaaagcacggcagcatcaagggcagcgtttcgttcctcatcaccggcgac
gaggaaggcccggccatcaatggcacggtcaagcttctcgactgggcgaagcagcgcggc
gaaagctgggatgcatccatcgtcggagagccaagcaacccgaatgcgctcggcgatgcg
atcaagatcggacgacgcggctcactgtccggcacgatcaccgtccatggcgtgcagggc
catgccgcctatccgcatctggccgaaaacccggtacgcggcattaccacgctggtcgac
agcctgctttatccggctttcgaccaagggacagccaattttcaggccagcaatctggaa
gtaaccagcatcgacgtcggcaacaaggccaccaatgtcattgcgaacaaggcaacggcc
tcgttcaacatccgcttcaacgacacctggacggcagagaccttgcaggccgaaatcatc
gcgcgcctcgaaaaagccgcccgcgacaatcgcttgcggccgggtcgcgaaacaccgatc
aaatacgaactcacctggcgcgagcatccgagccatgtgttcctgacccgtgacgaaaag
ctgatcggcacactgacagattccgtcgaggccgtaacgggcaaacgcccggaactgtcg
acatcaggcggcacgtccgatgcccgtttcatcaaggattactgtccggtggtcgagttc
ggccttgtcggacagaccatgcatatggttgacgagcgcgtagcccttgccgacctcgaa
ggcctgacacagatttatgaacgcttcatcgccgatttctttgggtaa

DBGET integrated database retrieval system