KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1767Help
Entry
Oant_1767         CDS       T00568                                 

Definition
FAD linked oxidase domain-containing protein
Orthology
K00102  
D-lactate dehydrogenase (cytochrome) [EC:1.1.2.4]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Oant_1767
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.4  D-lactate dehydrogenase (cytochrome)
     Oant_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1859862..1861271
Genome map
AA seq 469 aa AA seqDB search
MSLENVVALARNENGIAAAVGILKQRFGERAQTGQAIREQHGHTTTYVPTQAPDIVIFAE
TAQEVQDVVRICAEHRVPVIAFGAGSSLEGQVNAPAGGVSLDLTRMNRVIAVHAEDLDCV
VEPGITRRELNEYLRDTGLFFPIDPGANATLGGMASTRASGTNAVRYGTMRENVLALKAV
MPDGRLIETSKRVKKTAAGYDLTRLLVGAEGTLGIITELTLKLQGIPQAISGGICPFPDV
DSACRTVIETIQMGIPVARIELVNTLQMQALILHSKLPYEAQPYLFVEFHGTESGVAEQA
ELFGEIAAGNGGGNFQWTHDAEERDRLWRARHDAYLASFLLRPGCKGVSTDVCVPISRLA
DCIGETEKDLAETGLIAPIVGHVGDGNFHLLLLLDTEDASEMERAEAFMDRLTKRAIAME
GTCTGEHGIGQGKMKYLAMELGEATDYMRTIKKALDPDNIMNPGKILIS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttgaaaatgttgtcgcgcttgcacgcaatgagaacggtattgcagcagcagtg
ggtattctcaagcagcgtttcggtgagcgtgcgcagaccggtcaggctatccgcgagcag
cacggtcacacgacgacctatgtaccgacacaggcgccggacatcgtcatctttgcggag
actgcgcaggaggtgcaggatgttgtgcgtatctgcgccgaacatcgcgttccggttatc
gccttcggcgccggttcgtcgctcgaagggcaggtgaatgcgcccgctggtggtgtctct
cttgacctcacgcgcatgaacagggtgattgcggtgcacgcggaagatctggattgcgtg
gtggaaccgggcattacgcgccgggaactgaatgaatatctgcgcgatacgggactgttc
tttccgattgatccgggtgccaatgccacgctgggcggcatggcttccacccgtgcgtcc
ggtacgaatgcagtgcgttatgggaccatgcgcgagaatgtgctggcgctgaaagccgtg
atgcccgatgggcggttgatcgagacttccaagcgcgtgaagaagacggctgcgggttac
gatctcacgaggctgcttgtcggagccgagggaacacttggcatcatcaccgaactgaca
ttgaaactacaggggataccgcaggcgatctccggtggtatctgtcctttcccggatgtg
gattcggcttgccgcacggtgattgaaaccatccagatgggtatccccgttgcacgtatc
gagcttgtaaacacgcttcagatgcaggcgctgatcctccattccaaactgccttatgag
gcacagccctatctgtttgtcgagttccacggcacggaaagcggcgttgccgaacaggcg
gaattgtttggagaaattgctgcaggcaatggtgggggcaatttccagtggacccacgat
gctgaggaacgcgaccggctatggcgggcgcgtcacgacgcctatcttgcgtcctttctg
ctgaggcccggttgcaagggcgtttccaccgatgtctgcgtgccgatttcacgtcttgca
gactgcatcggcgagacggaaaaggaccttgccgaaacaggtcttatagcgccgattgtc
gggcatgtgggagatggtaatttccaccttctcctgcttctcgatacagaagatgccagc
gagatggagcgtgccgaagctttcatggatcggctgaccaagcgcgccattgccatggag
ggaacctgtaccggcgagcatggcatcgggcagggcaagatgaagtatctggccatggag
ctgggcgaagccacggactacatgcgaaccatcaagaaagcgctcgatcccgacaacatc
atgaatccgggtaaaatactgatttcctga

DBGET integrated database retrieval system