KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2048Help
Entry
Oant_2048         CDS       T00568                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01130  Biosynthesis of antibiotics
oan01230  Biosynthesis of amino acids
Module
oan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Oant_2048
Enzymes [BR:oan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Oant_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABS14764
JGI: Oant2048
UniProt: A6X0L0
Position
1:complement(2142115..2142915)
Genome map
AA seq 266 aa AA seqDB search
MSTDILRKIEAYKREEIAAAKAERTVADLKARAQDQEAPRGFFKALEAKRAAGEFALIAE
IKKASPSKGLIRPDFDPPALAKAYEAGGAACLSVLTDTPSFQGAPEFLTAARNACSLPAL
RKDFLFDTYQVHEARSWGADCILIILASVDDDLAKALEETAFELGMDALIEVHDEAEMER
ALKLSSRLLGVNNRNLRTFEVDLAVSERLSKMAPADRVLVGESGIFTHEDCLRLKKSGIG
TFLIGESLMRQADVAAATRELLTGKA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacattctgcgcaagatcgaggcttacaagcgcgaagaaatcgctgctgca
aaagccgagcgtaccgtcgctgatttgaaggcgcgcgcacaggatcaggaagcgccgcgt
ggctttttcaaagcgctggaggcaaaacgcgccgccggtgaattcgcgctgattgctgaa
atcaagaaggcaagcccatcgaagggcttgatccgtcctgatttcgatccgcctgcactt
gcaaaagcctatgaagctggtggcgctgcatgtctttcagtgctgactgacacaccttcc
tttcagggagcgccggaatttctgacggcagctcgcaacgcttgcagtctcccggctctg
cgcaaggattttctgttcgatacctatcaggtacacgaagcccgcagctggggcgcagat
tgcattctgatcattcttgcaagcgtcgacgatgatcttgcaaaggcgttggaagaaacc
gcgttcgagcttggcatggatgcactcatcgaggtgcatgacgaagccgagatggaacgc
gcactaaagctttcgtcgcgtctgctcggcgtcaacaatcgcaatttgcgtacatttgag
gtcgatctggccgtttcggaacggctgtcgaagatggcgccagccgatcgcgttctggtc
ggtgaaagcggcatattcacacacgaagattgcctgcgtctgaaaaagtctggaatcggg
acattcctcatcggagagagcctcatgcggcaggccgatgttgcagcggctacccgtgaa
ctgctgactggcaaggcctga

DBGET integrated database retrieval system