KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2051Help
Entry
Oant_2051         CDS       T00568                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_2051 (tpiA)
   01230 Biosynthesis of amino acids
    Oant_2051 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_2051 (tpiA)
   00051 Fructose and mannose metabolism
    Oant_2051 (tpiA)
   00562 Inositol phosphate metabolism
    Oant_2051 (tpiA)
Enzymes [BR:oan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Oant_2051 (tpiA)
Exosome [BR:oan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Oant_2051 (tpiA)
  Exosomal proteins of bladder cancer cells
   Oant_2051 (tpiA)
  Exosomal proteins of melanoma cells
   Oant_2051 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2146076..2146840
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGTGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHHKVSGAHTGDVSAEMLKEAGATHVIIGHSERRTDHHESNDTVRAKTEAA
WAAGLIAIVCVGETADERKAERTLDVIGKQLAGSLPDGVNAANTIIAYEPVWAIGTGLTP
TVQDVRAAHAFMREQLIERFGTKGAHLRLLYGGSVKPSNALELLGVADVDGALVGGASLK
ANDFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaagatgaatggcacgggagag
tccctgaccgaattgcgtgcgattgctgccggcctgagctccgatctcggccgcaagctt
gacgccgtcatttgtgtacctgcgacgcttctttcccgcgcggcggaaacgctcgaaggc
gagactgttggtctcggcggtcaggatgctcaccataaagtgtctggcgcgcatacaggc
gatgtctctgcagaaatgcttaaggaagcgggcgctacgcatgtcataatcggtcattcc
gaacgccggaccgaccatcatgaaagcaatgacactgttcgcgccaagaccgaggccgca
tgggctgccggattgattgcaatcgtttgcgtcggcgaaactgccgatgagcgcaaggcg
gagcgtactctggatgtaatcggcaagcagcttgctggctctttgccggatggcgtcaat
gccgcgaatacgatcattgcttacgaaccggtttgggcaatcggtacagggttgacgcca
acagtgcaggacgtgcgtgccgctcatgctttcatgcgtgagcagctaattgaacgtttc
ggcacgaaaggcgcacatcttcggctgctctatggcggttcggtcaagccttcaaacgca
ttggaattgctcggcgtcgcggatgttgatggtgcgcttgttggtggtgcgagcttgaag
gcgaacgattttctcgccatatgcgaaacctatcgtaatttgtaa

DBGET integrated database retrieval system