KEGG   Ochrobactrum anthropi: Oant_2115Help
Entry
Oant_2115         CDS       T00568                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
oan  Ochrobactrum anthropi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oan00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2217413..2218261
Genome map
AA seq 282 aa AA seqDB search
MTKEWHVAHGRSLRLGEKSVIMGILNVTPDSFSDGGHHNELERAVEVAGQMLADGATIID
VGGESTRPGAAAIDSETEIARVVPVIEALVKKYDCIISIDTYRAATAQAAVNAGAHIVND
VWGLQREPEIAHVAKRSGAGLVIMHTSRDRPVLADVIEDQFSFLNASLDIAKKAGIEETR
IVLDPGFGFGKNKDEDIALLARAGELQKFGFPLLVGTSRKRFIGGMTGRDNPLDRDIGTA
ATSVALRLAGADIFRVHNVAFNRDALAVADDILQSRRSENRK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagaatggcacgttgctcatggaagaagccttcgtctgggggaaaagtccgtg
atcatgggcatattgaatgtcacgccagactcattttccgatggcggccaccacaatgag
ctggaaagggccgtcgaagtggccggtcagatgctcgctgatggagcgacgatcattgat
gttggcggagaatcgacccggcccggagctgctgcgatcgattccgaaacggaaatcgcg
cgcgttgtcccggtcatcgaagcattggtgaaaaaatacgattgcatcatctccatcgac
acttaccgcgcagcaacagcgcaggcggcagtcaatgccggggcacatatcgtcaatgat
gtctggggactacaacgagaaccagaaatcgctcatgtcgccaaaaggagcggcgcaggg
ctggtcatcatgcataccagcagggatcgacccgttcttgctgatgtcatcgaggaccag
ttctcgttcctgaatgcttcactggacatagcgaaaaaggcaggcattgaagaaacccgc
atcgtactcgatcccggttttggtttcggcaagaacaaggatgaggatattgcgctgctg
gcgagagcaggcgaattgcagaaattcggatttccgttgctcgtcggcacgtcgcgcaaa
cgctttatcggcggcatgacgggcagggacaatccgctcgaccgcgacataggaactgcg
gcaacgtctgtcgcactgcgtttggcaggtgccgacatcttccgtgttcacaatgtcgct
tttaatagagatgcacttgccgttgcagatgatatcctgcaatccagacgcagtgaaaat
agaaagtaa

DBGET integrated database retrieval system