KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2115Help
Entry
Oant_2115         CDS       T00568                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00790  Folate biosynthesis
oan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Oant_2115
Enzymes [BR:oan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Oant_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABS14831
JGI: Oant2115
UniProt: A6X0S7
Position
1:2217413..2218261
Genome map
AA seq 282 aa AA seqDB search
MTKEWHVAHGRSLRLGEKSVIMGILNVTPDSFSDGGHHNELERAVEVAGQMLADGATIID
VGGESTRPGAAAIDSETEIARVVPVIEALVKKYDCIISIDTYRAATAQAAVNAGAHIVND
VWGLQREPEIAHVAKRSGAGLVIMHTSRDRPVLADVIEDQFSFLNASLDIAKKAGIEETR
IVLDPGFGFGKNKDEDIALLARAGELQKFGFPLLVGTSRKRFIGGMTGRDNPLDRDIGTA
ATSVALRLAGADIFRVHNVAFNRDALAVADDILQSRRSENRK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagaatggcacgttgctcatggaagaagccttcgtctgggggaaaagtccgtg
atcatgggcatattgaatgtcacgccagactcattttccgatggcggccaccacaatgag
ctggaaagggccgtcgaagtggccggtcagatgctcgctgatggagcgacgatcattgat
gttggcggagaatcgacccggcccggagctgctgcgatcgattccgaaacggaaatcgcg
cgcgttgtcccggtcatcgaagcattggtgaaaaaatacgattgcatcatctccatcgac
acttaccgcgcagcaacagcgcaggcggcagtcaatgccggggcacatatcgtcaatgat
gtctggggactacaacgagaaccagaaatcgctcatgtcgccaaaaggagcggcgcaggg
ctggtcatcatgcataccagcagggatcgacccgttcttgctgatgtcatcgaggaccag
ttctcgttcctgaatgcttcactggacatagcgaaaaaggcaggcattgaagaaacccgc
atcgtactcgatcccggttttggtttcggcaagaacaaggatgaggatattgcgctgctg
gcgagagcaggcgaattgcagaaattcggatttccgttgctcgtcggcacgtcgcgcaaa
cgctttatcggcggcatgacgggcagggacaatccgctcgaccgcgacataggaactgcg
gcaacgtctgtcgcactgcgtttggcaggtgccgacatcttccgtgttcacaatgtcgct
tttaatagagatgcacttgccgttgcagatgatatcctgcaatccagacgcagtgaaaat
agaaagtaa

DBGET integrated database retrieval system