KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2158Help
Entry
Oant_2158         CDS       T00568                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00790  Folate biosynthesis
oan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Oant_2158
Enzymes [BR:oan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Oant_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: ABS14874
JGI: Oant2158
UniProt: A6X0X0
Position
1:2266598..2267239
Genome map
AA seq 213 aa AA seqDB search
MDARILKEDDESGLPNKQADVTLLHGKPTQADAEAAVRTLLLWAGDDPEREGLLETPKRV
AKAYKELFAGYTESPEEVLGTVFEEVGGYNDLVLVKDISFHSHCEHHMVPIIGKAHVAYL
PDHKVVGLSKIARVVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRG
IRKQGSTTITTTFTGEMQVNAEEQVRFMTLTRR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcgcatcctcaaagaagatgacgaatccggcctgccgaacaagcaggcagat
gtaactcttttgcatggcaagccgacgcaggccgatgcagaagcagccgtacgcacgctt
ttgctttgggccggagacgacccggagcgtgaaggtcttctggaaacgccgaagcgcgtt
gccaaggcctataaggaactgttcgcaggttatacggaaagcccggaagaagttctcggc
acagtgttcgaggaagtcggtggctataacgatcttgtcctcgtgaaggacatttcgttc
cattcgcattgcgagcaccatatggtgccgatcattggcaaggcgcacgtcgcctatctg
cctgatcacaaggtggttggcctttccaagattgcccgcgtcgtggatattttcgcgcgc
cgcctgcagacacaggaaagcatcaccgcacaaatcgccgatagcatccagcgcattttg
aagccgcgtggcgtcgccgtcatgatcgaggccgagcacatgtgtatggccatgcgcggc
atccgcaagcagggttcgacgaccatcaccaccacttttaccggcgaaatgcaggtgaat
gcggaggaacaggttcgcttcatgaccctgacccgcagataa

DBGET integrated database retrieval system