KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2158Help
Entry
Oant_2158         CDS       T00568                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Oant_2158 (folE)
Enzymes [BR:oan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Oant_2158 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2266598..2267239
Genome map
AA seq 213 aa AA seqDB search
MDARILKEDDESGLPNKQADVTLLHGKPTQADAEAAVRTLLLWAGDDPEREGLLETPKRV
AKAYKELFAGYTESPEEVLGTVFEEVGGYNDLVLVKDISFHSHCEHHMVPIIGKAHVAYL
PDHKVVGLSKIARVVDIFARRLQTQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRG
IRKQGSTTITTTFTGEMQVNAEEQVRFMTLTRR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcgcatcctcaaagaagatgacgaatccggcctgccgaacaagcaggcagat
gtaactcttttgcatggcaagccgacgcaggccgatgcagaagcagccgtacgcacgctt
ttgctttgggccggagacgacccggagcgtgaaggtcttctggaaacgccgaagcgcgtt
gccaaggcctataaggaactgttcgcaggttatacggaaagcccggaagaagttctcggc
acagtgttcgaggaagtcggtggctataacgatcttgtcctcgtgaaggacatttcgttc
cattcgcattgcgagcaccatatggtgccgatcattggcaaggcgcacgtcgcctatctg
cctgatcacaaggtggttggcctttccaagattgcccgcgtcgtggatattttcgcgcgc
cgcctgcagacacaggaaagcatcaccgcacaaatcgccgatagcatccagcgcattttg
aagccgcgtggcgtcgccgtcatgatcgaggccgagcacatgtgtatggccatgcgcggc
atccgcaagcagggttcgacgaccatcaccaccacttttaccggcgaaatgcaggtgaat
gcggaggaacaggttcgcttcatgaccctgacccgcagataa

DBGET integrated database retrieval system