KEGG   Ochrobactrum anthropi: Oant_2369Help
Entry
Oant_2369         CDS       T00568                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
oan  Ochrobactrum anthropi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_2369
   00052 Galactose metabolism
    Oant_2369
Enzymes [BR:oan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Oant_2369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2491735..2492754)
Genome map
AA seq 339 aa AA seqDB search
MNSEIFGYAPDGQAVHRLTISNGPLTARIINWGAAIQDLRMEGHAAPLVIGYRDFADYPA
HSPHLGAIAGRSANRIRNARFDLDGTTCEVEPNFQGRHNLHGGSKGLGNRVWKITGNGPD
FVTLATVATDGEMGFPGNLNVSCTYMLTGDGTLIVRLEAVTDKPTVCNLLHHSYFNLDDG
GEGDILDHQLKIDADAYMPVDDALIPDGRVLPVKGTPFDFREFRPIRFEENGSQVQYDSN
FCLTAARGPLRPCASVKGARSGIRLDISTTEPGVQFYAGNTMANDCIGLMGKPYGKHAGF
CLEPQIWPGSLEYPYFPQAILRPGEIYAQTSHFSFSREK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcggaaatctttggatatgcaccggacgggcaggcggttcaccggctcacgatc
tccaatggcccgctgacggccaggatcatcaattggggcgcagccattcaggatctgcgc
atggagggccatgcggctccgctggtgatcggctatcgcgactttgccgattatccggcc
cattcaccgcatctgggtgcgattgcgggtcgttcggccaatcgtatccgcaatgcccgg
tttgatctggacggaacgacttgcgaggtagagccgaattttcagggccgccacaacctg
cacggcggcagcaaggggctcggcaatcgcgtctggaagataaccggaaacggtccggat
ttcgtgacgcttgcgacggtggcaaccgatggcgagatggggtttcccggcaacctgaat
gtcagctgcacctatatgctcaccggggatgggacgctcatcgtgcggctggaagcggtg
accgacaagccgaccgtctgcaacctgctgcatcacagctacttcaatctcgatgatggc
ggcgagggcgatatcctcgatcatcagctcaagatcgacgccgacgcctatatgccggtc
gatgatgctctcattccggacggacgcgttctgccggtcaaaggaacgcctttcgatttc
cgggagttccgtccgattcgctttgaggagaatggcagtcaggtccagtacgacagcaat
ttctgcctgaccgcagcgcggggaccattgcgcccatgcgcgtcggtcaagggcgctcgt
tccggtattcgtctcgatatctcaacgacagaaccgggcgttcagttctatgcaggcaac
accatggccaatgattgcatcggcctgatgggcaagccttacggaaaacacgcgggtttc
tgtcttgagccgcagatatggccgggatcgctggaatatccgtatttcccgcaggcaata
ttgcgtccgggcgagatttacgcccagaccagccatttcagcttttcacgcgaaaaataa

DBGET integrated database retrieval system