KEGG   Ochrobactrum anthropi: Oant_2499Help
Entry
Oant_2499         CDS       T00568                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
oan  Ochrobactrum anthropi
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:oan00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2627064..2628014
Genome map
AA seq 316 aa AA seqDB search
MPSKTIDHAITARSLTSAATDPTHAGVLSFMRRMYTKSLKGADAVVWGIPFDAAVSNRPG
ARFGPQAIRRASAIFDNDPQYPFERDLFENLAVIDYGDCLLDYGNHTKTPATIEREATKI
LKSDAFLLTLGGDHFITWPLLKAHAAKYGPLALVQFDAHQDTWFDDGKRIDHGSFVARAV
RDGIIDPDHSIQIGIRTHAPEDCGIKIIYGHEVEDISAVAIADEILKRTDGRKTYLTFDI
DCLDPAFAPGTGTPVAGGPSSAKMLSVLRKLTALDFVGADVVEVAPAYDHADITAIAGAT
IAMYYLGLLAEKKERR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaagactatcgaccacgcgattactgcccgcagcctgacaagcgcagcaacg
gacccgacccacgccggtgtattgtcgttcatgcggcgtatgtacacgaagtcgttgaag
ggcgcagacgccgttgtctggggtattccgttcgatgcagccgtatctaataggcccggc
gcacgtttcggtccgcaggcgatccggcgggcgtcggcgatcttcgacaatgatccgcaa
tacccgttcgagcgcgaccttttcgagaatctagccgtcatcgactatggcgactgcctg
ctcgactatggcaatcacaccaagacccctgccactattgaacgcgaagcgacaaaaatc
ctgaaatcggatgcgtttctgctaacgcttggcggcgatcatttcatcacatggccgctg
ctcaaggcccatgccgcgaaatatggtccactggcactcgttcagttcgacgcgcatcag
gatacgtggttcgacgatggcaagcgcatcgatcatggctccttcgtagcccgtgcggtg
cgcgacggcattatcgatccagatcactcgatccagatcggtatccgtacgcacgcgccg
gaagattgcggcatcaagatcatttatggccatgaggtcgaagacatctcggcggtggcg
attgccgatgaaatcctgaaacgcaccgatggcaggaagacatatctgaccttcgacatc
gactgccttgatccggcctttgcgccgggaaccggtacaccggtcgcaggcggaccgtcg
tctgcaaagatgctgtccgtcctgcgcaagctgacggctcttgactttgtgggcgcagat
gtggtcgaggttgcaccggcctatgaccatgccgatataacagcaatcgcgggagcgacg
atcgcaatgtattatctgggccttctggctgagaagaaagaacgacgatga

DBGET integrated database retrieval system