KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2535Help
Entry
Oant_2535         CDS       T00568                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00071  Fatty acid degradation
oan00280  Valine, leucine and isoleucine degradation
oan00281  Geraniol degradation
oan00310  Lysine degradation
oan00360  Phenylalanine metabolism
oan00362  Benzoate degradation
oan00380  Tryptophan metabolism
oan00410  beta-Alanine metabolism
oan00627  Aminobenzoate degradation
oan00640  Propanoate metabolism
oan00650  Butanoate metabolism
oan00903  Limonene and pinene degradation
oan00930  Caprolactam degradation
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01120  Microbial metabolism in diverse environments
oan01130  Biosynthesis of antibiotics
oan01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Oant_2535
   00650 Butanoate metabolism
    Oant_2535
  Lipid metabolism
   00071 Fatty acid degradation
    Oant_2535
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Oant_2535
   00310 Lysine degradation
    Oant_2535
   00360 Phenylalanine metabolism
    Oant_2535
   00380 Tryptophan metabolism
    Oant_2535
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Oant_2535
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Oant_2535
   00281 Geraniol degradation
    Oant_2535
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Oant_2535
   00627 Aminobenzoate degradation
    Oant_2535
   00930 Caprolactam degradation
    Oant_2535
Enzymes [BR:oan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Oant_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABS15248
JGI: Oant2535
UniProt: A6X1Z4
Position
1:complement(2661676..2662728)
Genome map
AA seq 350 aa AA seqDB search
MQIDFGGGSEISFERKGKAGLVKLTRTEALNALTHKMILALDRALQAWEDDPEVACVILE
GEGRAFCAGGDVVAAYKAGQAGTPAYEFFRDEYRLNARIGRFPKPYISLINGIVMGGGAG
ISVHGSHRIVTENTMFAMPETGIGFFPDVGGSAFLPHLHDNFGYYLALTGNRIRWGDCLQ
SGIATHAVAASDLHDLRDDIIATADIDAALTRSQYPDFETAVETRQIIAECFSGATLADC
MASLEKEAEAGSKAAMDIVKVIATRSPTSVAVTFRQIADGRPLDLDDCMRMEYRIANRML
EAHDFYEGVRALLIDKDGAPNWKPATLDEVKPEQVNVYFANLGDKELTLW
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgacttcggcggcggcagcgaaatcagctttgaacgcaagggaaaagcgggg
cttgtgaagcttacgcggaccgaggccctcaatgcgctcacgcataaaatgattctggcg
ctggatcgcgcattgcaggcctgggaagacgatcctgaagtggcctgtgtgattctcgaa
ggcgaagggcgcgcattctgcgcgggcggtgatgtggttgccgcctacaaggccggtcag
gccggaacacctgcttacgaattcttccgcgacgaatatcggctcaatgcgcgcattggc
cgttttccaaaaccctatatctcgctgatcaacgggatcgtcatgggcggtggtgcgggc
atttccgttcacggttcgcaccgcatcgtgacggaaaacaccatgttcgccatgccggaa
accggcatcggcttcttcccggatgtgggtggcagcgcttttctgccgcatctgcacgac
aatttcggatattatcttgcgctgaccggcaaccgtattcgctggggcgactgcctgcaa
agcggaattgcaacacacgccgtcgctgcaagcgatctgcatgatttgcgggacgacatc
attgcaaccgccgacattgatgcggctctgacgcgcagccagtatcccgattttgaaacc
gctgttgaaacgcgccagatcattgcggaatgcttttccggcgcgacgcttgccgactgc
atggcttcgctggaaaaggaagccgaagcgggcagcaaggccgcaatggacatcgtgaag
gtgatcgccacgcgttcaccaaccagtgtcgcggttactttccgccagattgccgatggt
cgtccgctcgatctcgatgattgcatgcgcatggaataccgcattgccaaccggatgctg
gaagcgcacgatttctatgaaggcgttcgcgcattgctcatagacaaggacggtgcgccg
aactggaaacccgcaacgctcgacgaagtgaagcccgaacaggtcaatgtctattttgca
aatctgggtgacaaggaactgaccttgtggtga

DBGET integrated database retrieval system