KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2906Help
Entry
Oant_2906         CDS       T00568                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Brite
Enzymes [BR:oan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Oant_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:complement(200213..200983)
Genome map
AA seq 256 aa AA seqDB search
MTKFWIGTSWKMNKTLAEARIFAEALKAADASRSTDIQRFVIPPFTAVREVKEILSGTSV
KVGAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREHFGETNETVGLKVEAAVRH
GLIPLICIGETLEDRESGRAAEVLEEEVRGALSKLSDDQKQAEILFAYEPVWAIGENGIP
ASADYADARQAEIIAVAESMLGRRVPCLYGGSVNPGNCEELIACPHIDGLFIGRSAWNVE
GYFDILAKCAAKIRAN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattctggattggcaccagctggaagatgaacaagacgctggccgaggcccgc
attttcgccgaagccttgaaagctgccgatgcaagccgctcgaccgacattcagcgtttc
gtcatcccgccctttaccgccgtgcgcgaagtgaaggaaatcctgtccggcacttccgtc
aaggtcggcgcgcagaacatgcattgggccgatcagggtgcatggaccggcgagatttcg
ccgctgatgctcaaggactgcaatctcgatatcgtcgagcttggccattccgagcgccgt
gaacatttcggtgaaaccaacgaaacggtcggcctcaaggtcgaagctgcggtgcgccac
ggcctgatcccgctcatctgcatcggtgagacgctggaagaccgcgaaagcggacgcgcc
gcggaagtgcttgaggaagaagtgcgcggagcactttccaagctttccgacgatcagaag
caggcggaaatcctgtttgcctatgagccggtctgggccatcggcgaaaatggtatcccg
gcatcagcagattatgccgatgcgcgccaggcggaaatcattgcggttgcagaaagcatg
ctcggtcgtcgcgtgccttgcctctatggcggctcggtcaatccgggcaattgcgaagag
ctgattgcctgcccgcacattgacgggcttttcatcggtcgctcggcatggaacgtcgaa
ggttatttcgacattctggccaagtgcgccgccaagattcgagctaattaa

DBGET integrated database retrieval system