KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2948Help
Entry
Oant_2948         CDS       T00568                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan01100  Metabolic pathways
oan01120  Microbial metabolism in diverse environments
oan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Oant_2948
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oant_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABS15656
JGI: Oant2948
UniProt: A6X352
Position
2:248176..248568
Genome map
AA seq 130 aa AA seqDB search
MRLSLLLVPLAFPAALFVSTAAFGAEDDASAGEKLFKRCSVCHTAEADKSKRGPSLNGVV
GRTAASYPGYPYSDAMRKAAAEGLVWNEDELKSFLRKPQARVKGTWMVFAGLTKEKDLEN
MIAYLKQHSE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgtcgcttcttcttgttcccctggcatttcccgctgcgctcttcgtctcaaca
gctgcctttggcgcggaggatgacgctagtgcgggagaaaaactcttcaagcggtgctcc
gtctgccacacagccgaggctgacaagagcaagcgtgggccgtcattgaacggtgtcgtg
ggccgaacagccgcatcctatcccggctacccctattcggacgcgatgcgcaaggccgcc
gccgaggggcttgtctggaatgaggatgaactgaagagctttctcaggaaaccgcaggcc
agggtcaaaggcacctggatggtttttgccggactgaccaaggaaaaagacctcgaaaac
atgattgcctatctgaaacagcattccgagtag

DBGET integrated database retrieval system