KEGG   Ochrobactrum anthropi: Oant_3411Help
Entry
Oant_3411         CDS       T00568                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
oan  Ochrobactrum anthropi
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Oant_3411
   00051 Fructose and mannose metabolism
    Oant_3411
Enzymes [BR:oan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Oant_3411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(751308..752615)
Genome map
AA seq 435 aa AA seqDB search
MSTGFFGDIQKVKYEGPDSDSPLAFRHYNPDEIVLGKRMEDHLRFAVAYWHSFAWEGGDP
FGGRTFDRPWYSNELDAAKLKADVAFEFFSLLGAPYYCFHDADVRPEGRNFAENTRYLNE
IVDIFEKKQAETGVKLLWGTANLFSNRRYMGGAATNPDPDVFAFAAATVKSCIDATKRLG
GENYVLWGGREGYETLLNTDLGRELDQMGRFLNLVVEYKHKIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKRYGLESEVKVNIEQGHAILAGHSFEHELALARALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYQVLLAGGFTTGGTNFDAKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAAAMLEDGALSKPLDERYAGWNGDFGKKLLTGLSLDQITAEVETKDINPQPK
SGRQEYLENVVNRYV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggatttttcggcgacattcaaaaggttaaatatgaggggccggacagtgat
agcccgctggcatttcgccactataatccggatgaaatcgtgctgggcaagcgcatggaa
gaccatctgcgctttgcagtcgcctactggcacagctttgcctgggagggtggcgacccg
ttcggcggacgcaccttcgaccgtccctggtattccaacgagctggatgcggcaaagctc
aaagctgacgtggctttcgagttcttctccctgcttggcgcgccctattattgcttccac
gatgccgatgtgcggcccgaaggacgcaactttgcggaaaacacacgatatctcaacgaa
atcgtcgatattttcgagaagaagcaggccgaaaccggcgtaaagctgctctggggcaca
gccaatctcttttccaaccgccgctatatgggcggggccgcaaccaatcccgatccagat
gtgttcgcctttgccgcagcgaccgtaaaaagctgcatcgacgcaacgaaacggctcggt
ggtgagaactacgtgctctggggtggtcgcgaaggctatgaaacgctgctcaacaccgat
cttggacgcgaacttgaccagatgggacggttcctcaatctggtggtcgaatacaagcat
aagatcggtttcaagggcacgatcctgatcgaaccgaagccgcaggagccgaccaagcat
caatatgattacgacgtcgcgacggtttatggcttcctgaagcgttacggcctcgaaagc
gaagtgaaggtcaatattgagcagggccacgccattctcgccggtcattcgttcgagcat
gaactggcgcttgcccgtgcacttggcattttcggttccatcgacatgaaccgcaatgac
tatcagtcaggctgggatacggaccagttcccgaacaatgtgccggaaatggcgctcgcc
tattatcaggtcctgctggcaggcggcttcaccaccggcggcacgaatttcgacgccaag
ctgcgccgtcagtcgctcgatccgcaagacctgctgatcggccatatcggtggcatggac
tgctgtgcacgcgggctgaaagcagccgccgcaatgcttgaagacggcgccttgtccaag
ccgctcgatgagcgttatgcaggctggaacggcgatttcggcaagaagcttttgactggc
ctctcgctggaccagatcacagctgaagtcgaaacgaaggacatcaatccgcagccgaaa
tccggccgccaagagtatctcgaaaacgtcgtcaatcgctacgtttga

DBGET integrated database retrieval system