KEGG   Ochrobactrum anthropi: Oant_3581Help
Entry
Oant_3581         CDS       T00568                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
oan  Ochrobactrum anthropi
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:oan01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:oan00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:954735..956051
Genome map
AA seq 438 aa AA seqDB search
MSDVSFHELAKLGDAARAELLKRSETDLSGFIEKVKPIIEAVRTEGDAALVRFARDLDKA
EVDPANIKATEAEFDAAFDKVEKDVIEAIQFGIDNIRHFHEEQKPEAMWLKEMRPGAFAG
DRFTPIRSVALYIPRGKGAFPSVTMMTAVPAVVAGVPDLAIVTPPTPDGSVDAATLVAAR
LAGVETVYKVGGAQAVAAVAYGTETVKPALKIVGPGSPWVVAAKRLLGGVIDPGLPAGPS
EAVIFADDTVKGGLAALDLLIEAEHGPDSSAWLVTHSRRVAEEALAALPDHWARMTEQRV
GFSKTVLTGKYGGIVLTSSVEESYKFINDYAPEHLELLSTDPFAHLGHITEAAEILMGPH
TPVVIGNFGLGPNAVLPTSRWARTYGPLSVTDFVKRSSIGYVTASAYPEFAKHARTLARY
EGFSSHENAVSEIRKDYL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgtttcttttcacgaactggctaaactgggcgatgcagcgcgcgccgaactt
ctcaagcgctcggaaaccgacctgtcgggctttatcgagaaggttaagccgatcatcgaa
gccgttcgcaccgaaggcgacgcggcgcttgtccgctttgcgcgcgatctcgacaaggca
gaagtcgatccggcgaacatcaaggcgacggaagccgagttcgatgccgctttcgacaag
gtggaaaaggacgtgatcgaggcgatccagttcggtatcgacaatatccgccatttccat
gaggagcagaagccagaggccatgtggctgaaggaaatgcgtcccggtgcctttgcaggc
gaccgtttcacgccgatccgttccgtcgcgctctatattccgcgtggcaagggggcgttt
ccgtccgtcaccatgatgaccgccgttccggctgtggttgctggcgtgcctgatcttgcc
atcgtcaccccgccgacgccggatggttccgtcgatgctgccacgctcgttgcagcacgc
cttgccggtgtggaaaccgtctacaaggttggcggtgcgcaggccgttgctgccgtcgcc
tatggcacggaaacggtgaaaccggcgctcaagatcgttggccccggcagcccatgggtg
gtcgcagccaagcgcctgctcggcggcgtcatcgatcccggcctgcctgcgggaccttcc
gaagctgtcattttcgccgacgacacagtgaaaggtggccttgcggcgctcgatctgctg
atcgaggcggaacatggcccggattcgtcggcatggctcgtcacgcatagccgccgcgtc
gcggaagaagcgctggctgcattgccggaccattgggcgcgcatgaccgaacagcgtgtc
ggcttctccaaaaccgtacttaccggcaaatatggtggcatcgtcctgacgtcttccgtg
gaagagagctacaagttcatcaacgactatgcgccggaacatctggagcttctttcgacc
gatccgttcgcgcatctcggccatatcacagaagctgccgaaatcctgatgggaccgcac
acgccggtcgtcatcggcaatttcggcctcggccccaatgccgtgctgccgaccagccgc
tgggcgcgcacctatggtccgctttcggtaacggatttcgtcaagcgttcgtccatcggc
tatgtgacggcttccgcctatccggaatttgcaaaacatgcccgcacactggcgcgttac
gaagggttctcctcacacgagaacgccgtgtcagaaatccgcaaggattacctctag

DBGET integrated database retrieval system