KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3817Help
Entry
Oant_3817         CDS       T00568                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K17315  
glucose/mannose transport system substrate-binding protein
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
ABC transporters
Module
Glucose/mannose transport system
Brite
KEGG Orthology (KO) [BR:oan00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Oant_3817
Transporters [BR:oan02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Glucose/mannose transporter [MD:M00605] [OT]
    Oant_3817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
2:complement(1215924..1217189)
Genome map
AA seq 421 aa AA seqDB search
MHKLLKLAAMGTAACALLAGMAPVASAQDKQNVEVLHWWTAGGEAAALDVLKKDLEKKGI
SWTDMPVAGGGGTEAMTVLRARVTAGNAPTAVQMLGFDIRDWAEQGALGNLDEIANKEGW
EKVIPAPLQEFAKYDGHWIAAPVNVHSTNWMWINKAALDKAGGKEPTNWDELIALLDKFK
EQGITPIAHGGQPWQDATIFDAVVLSFGTDFYKKAFIDLDPETLGSDTMKQAFDRMTKLR
SYVDDNFSGRDWNLASAMVIEGKAGLQFMGDWAKGEFVKAGKKPGEDFVCMRYPGTQGAI
TFNSDMFAMFKVSEDKVPAQLEMASAIESPTFQSAFNVVKGSAPARTDVPDTDFDACGKK
AIADEKEASEKGTMLGSMAHGYANPAAVKNAIYDVVTRQFNGQLSSEDAVKELVSAVEGA
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcataaacttttgaagctcgccgcgatgggtacagccgcctgtgctttgctcgccgga
atggcccctgttgccagtgcgcaggataagcagaatgttgaagttctgcattggtggact
gctggcggtgaagccgccgcgctcgacgttctcaagaaggatctcgaaaagaagggcatt
agctggaccgatatgccggttgccggtggcggtggtacggaagccatgacagtactgcgc
gcgcgcgtcacagctggaaatgctccgacggcagtgcagatgctcggcttcgacatccgc
gattgggcagagcagggtgctcttggtaatcttgatgagatcgcaaacaaggaaggttgg
gaaaaggtcattccggctcctctgcaggagtttgccaagtatgacggccactggatcgct
gctcctgtcaatgttcactccaccaactggatgtggatcaacaaggcagcgctcgacaag
gctggcggcaaggagcctaccaactgggatgaactgatcgctctccttgataagttcaag
gaacagggcatcactccgatcgctcatggcggccagccatggcaggacgcaacgatattt
gatgctgtagtgctttctttcggtacagatttctacaagaaggccttcatcgatctggat
cccgaaacgctcggcagcgatacgatgaagcaggcttttgatcgtatgacgaagctgcgt
tcctatgttgacgataacttctccggtcgcgactggaacctggcttcagctatggtcatt
gaaggcaaagccggccttcagttcatgggcgactgggcgaagggtgagtttgtcaaggct
ggcaagaagccgggcgaagacttcgtctgcatgcgctatccgggcacccagggcgctatc
acattcaactccgatatgtttgccatgttcaaagtctcggaagacaaggttcctgcacag
cttgaaatggcatcggcgattgaaagtccgactttccagtcggcattcaacgtagtgaag
ggctccgctccggctcgtaccgatgtgcctgataccgacttcgatgcttgcggcaagaag
gctatcgctgacgaaaaggaagcgagtgaaaaaggcacgatgctgggctccatggcgcat
ggttacgctaaccctgctgcggtgaagaatgcgatctatgacgtcgtaacacgccagttc
aacggtcaactttcctcggaagatgccgtcaaagaactcgtgtcggctgttgaaggtgca
aaataa

DBGET integrated database retrieval system