KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3883Help
Entry
Oant_3883         CDS       T00568                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Oant_3883
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_3883
  Lipid metabolism
   00071 Fatty acid degradation
    Oant_3883
  Amino acid metabolism
   00350 Tyrosine metabolism
    Oant_3883
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Oant_3883
   00626 Naphthalene degradation
    Oant_3883
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Oant_3883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1293413..1294585
Genome map
AA seq 390 aa AA seqDB search
MTTLTAKWNFPTTVLFGPGRIKELPVVLKAAGIQNPLFVTDPGLAKLPVVASTLAILDEA
GVKYGVFSDVKPNPVESNLYAGVEVFKSGKHDGVIAFGGGSALDLGKLIAFQAGQTRPVW
DFEDIGDWWTRADSKAIAPIIAVPTTAGTGSEVGRAGVLTNEATHTKKVIFHPKMLPITV
IADPELSTGMPPFITAGTGMDALAHCLEAYCAPGFHPMADGIAVEGIRLVLENLPTAYAD
GKNIEARANMMAAAAMGATAFQKGLGAIHSLSHPIGALYDTHHGMTNAVFMPYVLLQNRS
AIEKRIERLADYLGIKGGFDGFLAAVMKLRSDLSVPNTLPEFIKGLTMDDARKDLIAEMA
IVDPTAGGNPIELTKERALKLLNAALEGKV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccactttgactgccaaatggaatttccccaccaccgtgctttttggcccaggccgc
atcaaggaattgcctgtcgtcctcaaggccgctggcattcagaatccgctctttgtgact
gaccccggtctggcaaaacttccagtggtggcgtccacgctcgctattctggatgaagct
ggtgtgaaatacggggttttctccgacgtcaaacctaatccggtcgaaagcaatctctat
gcgggcgttgaggtcttcaaaagcggcaagcatgatggcgtcatcgcttttggtggtggt
tcagcgctcgacctcggcaagctgattgcctttcaggcagggcagacacgaccggtctgg
gatttcgaagacattggtgactggtggacgcgcgctgacagcaaagcaattgccccgatc
attgccgtgcccacgaccgctggcaccggatcggaagttggccgtgcaggtgtcttgacc
aacgaagcgacccataccaagaaggtcatcttccatcccaagatgctgccgatcacagtc
attgccgatcctgagctttccaccggaatgccacctttcatcactgcgggcactggcatg
gacgcactggcacactgccttgaagcctattgcgctccgggatttcatccgatggccgat
ggcatcgcggtggagggtatccgtctggttcttgaaaaccttcccaccgcctatgccgat
ggcaagaatattgaagcgcgtgcgaacatgatggcagcggccgcaatgggtgcaacagcc
ttccagaaagggcttggtgcaatccattccctgtcgcatcccatcggtgccctttatgat
acccatcatggcatgacgaatgcggttttcatgccctatgtcctgcttcagaaccgatct
gccatcgaaaagcgtatagaacggcttgccgattatctcggcatcaagggcgggttcgac
ggatttctggcagcagtcatgaaattgcggagcgatttgagcgtccccaatacgctgccc
gaattcatcaaaggcctcacaatggatgacgcccggaaagacctgattgccgagatggct
atcgtcgatccgaccgctggcggcaacccgattgaattgacaaaagaacgcgcgttgaag
ttgctaaatgctgcactcgaaggtaaggtctga

DBGET integrated database retrieval system