KEGG   Ochrobactrum anthropi ATCC 49188: Oant_3930Help
Entry
Oant_3930         CDS       T00568                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_3930
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Oant_3930
Enzymes [BR:oan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Oant_3930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1345895..1347184
Genome map
AA seq 429 aa AA seqDB search
MTDFYSLIPSAPKGRFDGIQRAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINKT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTATLVIARTDAEAAKLLTSDIDERDK
PFVDYDAGRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLEQARRFAEAVHKA
HPGKKLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNFGMFELARS
YKDRQMAAYSELQQAEFAAEANGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMKESTE
TAQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacagccttattccttcggcaccaaagggtcgcttcgacggcatccag
cgtgcgcatacggccgaagatgtaaaaaggctgcgtggttcggtggagatcaagtattcg
ctggccgagatgggcgccaaccgcctctggaagctgatccatgaggaagatttcgtcaat
gcgctgggcgcactttccggcaatcaggccatgcagatggttcgcgccggactgaaggca
atctacctctccggctggcaggttgcagcggatgcgaacacggcttcggccatgtatccg
gaccagtcactctatccggcgaatgccgccccagaactggccaagcgcatcaacaagacg
ttgcagcgtgccgaccagattgaaaccgccgaaggcaagggactttcggtcgatacctgg
tttgcccccatcgttgccgacgctgaagcaggcttcggtggcccgctgaacgctttcgag
atcatgaaagccttcatcgaggcgggtgcagcaggcgttcactacgaggaccagctcgcc
tcggaaaagaagtgcggccatcttggcggcaaggttctgatcccgacggcagcgcacatc
cgcaaccttaacgcggcgcgcctggctgctgacgtgatgggaacggcaacgctggttatc
gcccgcacggatgcggaagccgccaagcttctgacttcggatatcgatgagcgcgacaag
cctttcgtcgattacgatgcgggccgcacggcggaaggcttctatcaggtgaagaacggc
attgagccatgtatcgcccgtgcgattgcctatgcgccttattgcgatctgatctggatg
gaaacatccaagcctgatctcgaacaggcccgccgcttcgcggaagccgtgcacaaggca
catccgggcaagaagctcgcttataattgctcgccgtcgttcaactggaagaagaacctc
gacgatgccacgattgccaagttccagcgcgagctgggcgcgatgggctacaagttccag
ttcatcacgctggccggtttccaccagctcaacttcggcatgttcgaactggcacgcagt
tacaaggatcggcagatggcagcctattccgaattgcaacaggcggaatttgcagccgaa
gccaacggctacaccgcgaccaagcatcagcgtgaagtcggcaccggctatttcgatgcc
gtatcgctcgcaatcaccggcggccagtcttcgaccaccgccatgaaggaatcgactgaa
acagcacagttcagaccggctgctgaataa

DBGET integrated database retrieval system