KEGG   Ochrobactrum anthropi: Oant_3930Help
Entry
Oant_3930         CDS       T00568                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
oan  Ochrobactrum anthropi
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:oan01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:oan00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1345895..1347184
Genome map
AA seq 429 aa AA seqDB search
MTDFYSLIPSAPKGRFDGIQRAHTAEDVKRLRGSVEIKYSLAEMGANRLWKLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINKT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTATLVIARTDAEAAKLLTSDIDERDK
PFVDYDAGRTAEGFYQVKNGIEPCIARAIAYAPYCDLIWMETSKPDLEQARRFAEAVHKA
HPGKKLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNFGMFELARS
YKDRQMAAYSELQQAEFAAEANGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMKESTE
TAQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacagccttattccttcggcaccaaagggtcgcttcgacggcatccag
cgtgcgcatacggccgaagatgtaaaaaggctgcgtggttcggtggagatcaagtattcg
ctggccgagatgggcgccaaccgcctctggaagctgatccatgaggaagatttcgtcaat
gcgctgggcgcactttccggcaatcaggccatgcagatggttcgcgccggactgaaggca
atctacctctccggctggcaggttgcagcggatgcgaacacggcttcggccatgtatccg
gaccagtcactctatccggcgaatgccgccccagaactggccaagcgcatcaacaagacg
ttgcagcgtgccgaccagattgaaaccgccgaaggcaagggactttcggtcgatacctgg
tttgcccccatcgttgccgacgctgaagcaggcttcggtggcccgctgaacgctttcgag
atcatgaaagccttcatcgaggcgggtgcagcaggcgttcactacgaggaccagctcgcc
tcggaaaagaagtgcggccatcttggcggcaaggttctgatcccgacggcagcgcacatc
cgcaaccttaacgcggcgcgcctggctgctgacgtgatgggaacggcaacgctggttatc
gcccgcacggatgcggaagccgccaagcttctgacttcggatatcgatgagcgcgacaag
cctttcgtcgattacgatgcgggccgcacggcggaaggcttctatcaggtgaagaacggc
attgagccatgtatcgcccgtgcgattgcctatgcgccttattgcgatctgatctggatg
gaaacatccaagcctgatctcgaacaggcccgccgcttcgcggaagccgtgcacaaggca
catccgggcaagaagctcgcttataattgctcgccgtcgttcaactggaagaagaacctc
gacgatgccacgattgccaagttccagcgcgagctgggcgcgatgggctacaagttccag
ttcatcacgctggccggtttccaccagctcaacttcggcatgttcgaactggcacgcagt
tacaaggatcggcagatggcagcctattccgaattgcaacaggcggaatttgcagccgaa
gccaacggctacaccgcgaccaagcatcagcgtgaagtcggcaccggctatttcgatgcc
gtatcgctcgcaatcaccggcggccagtcttcgaccaccgccatgaaggaatcgactgaa
acagcacagttcagaccggctgctgaataa

DBGET integrated database retrieval system