KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4115Help
Entry
Oant_4115         CDS       T00568                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_4115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oant_4115
   00020 Citrate cycle (TCA cycle)
    Oant_4115
   00620 Pyruvate metabolism
    Oant_4115
Enzymes [BR:oan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Oant_4115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1545935..1547266)
Genome map
AA seq 443 aa AA seqDB search
MAVEVILPKVDMDMETGQISRWYAKDGDTVTKGQLLFEIETDKAAMEVDAPASGIIADIS
AAEGTVVPVGQTVAWIYDEGEERSAKSAPVVEEPIVAVPVETIIETVAPNPVEPKSSQDD
KNGSADDVRATPLARRLAREAGIDLATIQGSGPKGRVQKKDVEGNTGIAKHTVSAKSPAI
KNAEPSAPGQLNAVWLREGEADRLPIVLIHGFAADLNSWRGLFAGASLGHPILALDLPGH
GNSPRVVPESIDDIATAVEATLSAFGVTSCLLVGHSLGGAVATVTAARGVVDVRSLLLIS
SGGLGPQVNGAFIKGLVGAKSEASIVPWLKLLVADESHLTKPFINATVAQAADAELRDTQ
EAIGHRFFADGTQTFEVRSSIASLAMPVRLIFGAEDRVIPVAQAHGLPGKVGVHIFAGCG
HMPQIEERAAVLQILKECAAAAN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggaagtcattctccccaaggtcgatatggatatggagacggggcagatttcg
cgctggtatgccaaggatggtgatactgtcacgaagggccagcttctctttgaaattgag
actgacaaggcggcgatggaagtcgatgctccggcatcaggcatcattgcggatatcagt
gccgcagaaggcactgttgtcccggttggtcagactgtcgcctggatttacgacgaaggt
gaagaacgtagtgccaagtcagcgcccgtcgttgaagagccaattgttgctgtgcccgtc
gaaactatcattgagacggtagcaccaaacccggttgaaccaaaatcctcccaagacgat
aaaaatggttcagctgatgatgtgcgggcaacgccgcttgcacggcggctcgcccgtgaa
gcaggcattgatctcgccaccattcagggctcaggtccgaagggccgcgtgcagaagaag
gacgttgaaggcaataccggcattgcgaagcatacagtatcggctaaatcgcctgcgatt
aaaaatgctgaaccatccgcgcccggtcagctcaatgcagtctggttgcgtgagggcgag
gccgatcggttgccgattgtgctgatccacggctttgccgcagacctcaactcatggcgt
ggcttgtttgccggggcatcgcttggccacccgatactggcgcttgatcttccgggacac
ggtaattcgccacgtgttgttcctgaaagcatcgatgatattgctacggcagtcgaagcg
acgctttctgctttcggcgtgacgtcgtgcctgctggttggtcactcgcttggcggagcc
gtcgccacagtcaccgctgcgcgtggtgttgtcgatgtgcgttccctgttgcttatttct
tcggggggcttgggaccgcaggtcaacggcgcgttcataaaaggtctcgtcggcgcgaaa
agcgaagccagcatcgttccctggttgaaactgctcgttgccgatgagagccatctgacg
aagccgttcatcaatgcaacagttgctcaagccgctgatgcagaactgcgcgatacgcag
gaagcgattggtcatcggttttttgcggatggcacacagacttttgaggttcgttcaagc
attgcttcgcttgcaatgccggtgcggctcatcttcggtgccgaagatcgggttattccc
gttgcccaggcccatggtttgccagggaaagttggcgtccacattttcgcaggttgtgga
catatgccacaaatcgaagagcgggctgcggtgttgcaaattctcaaagaatgcgccgcc
gctgccaattaa

DBGET integrated database retrieval system