KEGG   Ochrobactrum anthropi: Oant_4281Help
Entry
Oant_4281         CDS       T00568                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
oan  Ochrobactrum anthropi
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:oan00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1716836..1717828
Genome map
AA seq 330 aa AA seqDB search
MSELLFETDANPIPHGIKAGLLEAKGGKTLRYAILKADAKPIRGTVVLLQGRNEFIEKYF
ETMTDLTARGFTVVTFDWRGQGGSHRLLKDRQRGYVRSFEDYSDDLDLILDQIALPDCPP
PFYILGHSAGALVALSSMGRLTSRISRMVLCAPFMGLDGQRLSDDNVRRIASAFRWLGLG
QVYASGGRRLASRPFAGNPLTSDPARFMRNMEIPRLHPDLALGGPTARWLWSALETSRRI
NQPDFYNGPTVPVLIVAAGADRVVSTSVIERFVARTRNVSLTTITGARHEMLQEADFYRE
QLWAAFDAFIPGSSEVETMPETIEPLASGI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactacttttcgaaaccgatgcgaatcctataccgcacgggatcaaggctggc
ctgcttgaagcgaagggcggcaagaccctgcgctatgccattctgaaagccgacgcgaaa
ccgatacggggaacagtggtcctgcttcagggacgcaacgagtttatcgaaaaatacttc
gaaaccatgaccgatctgaccgcgcgcggcttcacggtcgtaacattcgactggcgcgga
caaggcggctcgcaccggttgctgaaggaccgccagcgcggctatgtccgcagtttcgaa
gattattccgacgatctcgaccttatccttgaccagatcgccttgcccgactgtcccccg
cccttctacattctcggccattccgccggtgcgcttgtggcgctttcttcgatgggcaga
ctgacatcgcgcatcagtcgcatggtgctgtgtgcgcccttcatggggcttgatgggcaa
cggctcagcgatgacaatgtacgccgcatcgcctccgcctttcgatggctcggcctcggc
caagtttacgcatccggcggacgcagactggcttcgcgtccctttgcaggcaatccgctg
accagcgacccggcacgcttcatgcgtaatatggaaattccacgccttcacccggatctt
gcgcttggcggtccgaccgcccggtggctctggagcgctctcgaaacgtctcggcgcatc
aatcagccggatttctataatggacccacagtaccggtcctcatcgttgccgctggcgca
gaccgcgtggtttccacatcggtgatcgagcgttttgtcgcccgcacgcgcaatgtctca
ctgaccacaattaccggcgcacgtcatgagatgcttcaggaagccgacttttatcgtgag
cagctctgggccgccttcgatgccttcattccgggctcgtcagaggtcgaaaccatgccg
gagaccattgagcccctagcctccggtatttag

DBGET integrated database retrieval system