KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4285Help
Entry
Oant_4285         CDS       T00568                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Brite
Enzymes [BR:oan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Oant_4285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1721185..1721838
Genome map
AA seq 217 aa AA seqDB search
MRNFEKARVQMVEQLVHRGIHDTRVLEAMGTLAREKFIDEGFIEFAYDDTPLPIKNGQTI
SQPYMTAFMIASAHLGGGEHVLEIGTGSGYAAAIIAQIAGQIFTVERYSTLAEAAQQRFE
DLGCDNIHVRTGDGSNGWPEEAPFDAIIVAAGAPEIPSPLKEQLKPGGRLIIPVGSMAGT
QRLLCITRKSTEEFDEEDLGGVMFVPLVGNKAWPDMN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattttgagaaagctcgtgtccaaatggtggagcagcttgtccatcgcggtatc
catgacacgcgcgtgctggaagcgatgggcacgttggctcgtgagaaattcatcgatgaa
ggctttatcgagtttgcctatgacgacacacctctaccaatcaaaaatggccaaacgatc
tcacaaccatatatgactgcctttatgattgcatcggcgcatctgggtgggggtgaacac
gttctcgaaattggaacaggctccggctacgctgcggcgatcatagcacagattgccggt
cagatatttactgtcgaacggtattccacccttgccgaagccgcgcaacaacgcttcgaa
gacctcggctgcgataatatccatgtgcgcacgggcgacggcagcaatggttggccagaa
gaagctcctttcgacgcgataattgttgcagcgggtgctccggaaatcccctccccgctc
aaagagcagctcaaaccaggcgggcggctcatcataccggtcggcagtatggcgggtacc
cagcgccttttgtgcatcacccgtaaatctacggaggaattcgacgaggaagatctcggc
ggtgtgatgttcgtaccgcttgtgggaaataaggcctggcccgacatgaactga

DBGET integrated database retrieval system