KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4285Help
Entry
Oant_4285         CDS       T00568                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Brite
Enzymes [BR:oan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Oant_4285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 GCD14 RrnaAD Methyltransf_23 Methyltransf_4 MTS Methyltr_RsmB-F Ubie_methyltran Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ABS16985
JGI: Oant4285
UniProt: A6X6Y1
Position
2:1721185..1721838
Genome map
AA seq 217 aa AA seqDB search
MRNFEKARVQMVEQLVHRGIHDTRVLEAMGTLAREKFIDEGFIEFAYDDTPLPIKNGQTI
SQPYMTAFMIASAHLGGGEHVLEIGTGSGYAAAIIAQIAGQIFTVERYSTLAEAAQQRFE
DLGCDNIHVRTGDGSNGWPEEAPFDAIIVAAGAPEIPSPLKEQLKPGGRLIIPVGSMAGT
QRLLCITRKSTEEFDEEDLGGVMFVPLVGNKAWPDMN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattttgagaaagctcgtgtccaaatggtggagcagcttgtccatcgcggtatc
catgacacgcgcgtgctggaagcgatgggcacgttggctcgtgagaaattcatcgatgaa
ggctttatcgagtttgcctatgacgacacacctctaccaatcaaaaatggccaaacgatc
tcacaaccatatatgactgcctttatgattgcatcggcgcatctgggtgggggtgaacac
gttctcgaaattggaacaggctccggctacgctgcggcgatcatagcacagattgccggt
cagatatttactgtcgaacggtattccacccttgccgaagccgcgcaacaacgcttcgaa
gacctcggctgcgataatatccatgtgcgcacgggcgacggcagcaatggttggccagaa
gaagctcctttcgacgcgataattgttgcagcgggtgctccggaaatcccctccccgctc
aaagagcagctcaaaccaggcgggcggctcatcataccggtcggcagtatggcgggtacc
cagcgccttttgtgcatcacccgtaaatctacggaggaattcgacgaggaagatctcggc
ggtgtgatgttcgtaccgcttgtgggaaataaggcctggcccgacatgaactga

DBGET integrated database retrieval system