KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4346Help
Entry
Oant_4346         CDS       T00568                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Oant_4346
Enzymes [BR:oan01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Oant_4346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1774854..1776770)
Genome map
AA seq 638 aa AA seqDB search
MSEETKKTQLSRRQLLGSSAFVAAAGAGGLGGALFAGSTEPAIAAAGGAGHSAEVKPGEL
DEYYVFFSSGQSGEVRIVGLPSMRELMRIPVFNRDSATGWGQTNESLKVLTEGLLPQDQE
FLKDRGGIFLNGDLHHPHPSFTEGTYDGRYLYANDKANTRVCRIRLDVMKCDKIIQLPNQ
HTVHGLRVQKYPKTGYVFCNGEDRAPIPNDGSNLTDTKQYHAIFTAVDGETMKVAWQIMV
DGNLDNVDCDYQGKYAFATCYNSEEGTTLAEMMSSEQDWIVIFNLKRIEEAVAKGDFKEI
NGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDELFDD
KIKPRDAVVAEPELGLGPLHTAYDGKGNAYTTLFIDSQICKWNIEDAKRAFKGEKVDPIR
QKLDVHYQPGHNHTSMGQTKEADGQWLISLNKFSKDRYLNVGPLKPENDQLIDISGEKMM
IVHDGPSFAEPHDATIVHRSKINPVNFWSREDPFFADAVTQAKADGLDLMDANEVIRDGN
KVRVYMTSAAPAFGLTEFTVQQGDEVTVYVTNIDEIEDLTHGFAIINYGVNMEIGPQATA
SVTFTANKPGVWWYYCSWFCHAMHMEMKGRMLVEPKKA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaaaccaaaaaaacgcagcttagtcgaagacagctgctcggctcgtcagcc
tttgtggctgctgccggtgcaggcggtcttggtggagcgctgtttgcaggttcaaccgaa
ccggcaatagctgctgccggcggtgctggccacagtgcagaggtgaagcctggagaactg
gacgaatattacgtcttcttttccagcggtcagagcggtgaggtccgtattgtcggcttg
ccgtcgatgcgcgaactgatgcgcattccggtgttcaatcgcgatagcgcgaccggctgg
ggccagacaaatgaaagccttaaggtgctgaccgaaggccttctgccgcaggaccaagag
ttcctcaaagatcgcgggggcattttcctgaatggtgacttgcaccacccgcacccgtcc
ttcacggaaggcacctatgacggacgctatctctacgccaacgacaaggccaatacgcgt
gtctgccgcatccgtcttgatgtgatgaaatgcgacaagatcattcagctcccgaaccag
cacaccgtgcatggcttgcgcgtgcagaaatatccgaaaaccggatatgtcttctgcaac
ggtgaagatcgcgcgccgatcccgaacgacggcagcaatctgaccgataccaagcaatat
cacgcgatcttcacggccgttgacggcgagaccatgaaggttgcctggcagatcatggtc
gatggcaatctcgacaatgtcgactgcgattatcagggcaaatatgcttttgccacctgc
tacaattcggaagagggtacgacgctcgccgaaatgatgtcgagcgagcaggactggatc
gtcatcttcaacctgaagcgtatcgaagaagcggttgccaagggtgatttcaaggaaatc
aacggtgtgccggtcatcgatggacgtcacggttccaaatatacgcgttacattcctgtg
ccgaacagcccgcatggcatcaacactgcgccagacggtatccatgtggttgccaacggc
aagctctcgccgaccgttaccgtgttcgacgttcgcaagttcgatgagcttttcgacgac
aagatcaagccccgcgatgcagtcgttgcggaacctgaactcggacttgggccattgcat
acggcttatgatggcaagggcaacgcctatacaacgctcttcatcgacagccagatctgc
aaatggaatatcgaggacgccaagcgagccttcaagggtgaaaaggtcgatccgatccgt
cagaaactcgatgtgcattatcagcccggtcacaatcacacttccatggggcaaaccaag
gaagccgacggtcagtggctgatttcgctcaacaagttctccaaggatcgctatctcaat
gtcggcccactcaagccggaaaatgaccagctcatcgatatttccggtgagaagatgatg
attgtccatgacgggccaagttttgctgagccgcacgatgcaacgattgttcatcgttcc
aagatcaatcccgtcaacttctggagccgtgaggatccattcttcgccgatgctgtcact
caggcgaaagccgatggcctcgacctgatggacgcgaatgaggtgatccgggatggcaat
aaggtgcgcgtttatatgacgtctgccgcgccagccttcggtctaaccgagttcaccgtc
cagcagggcgatgaggtgacggtgtatgtcaccaatatcgacgagatcgaagatcttacg
cacggcttcgccatcatcaattacggggtcaacatggagatcgggccacaggcgaccgcg
tctgtcaccttcacggccaacaagccgggcgtgtggtggtattactgctcgtggttctgc
cacgccatgcacatggaaatgaagggccggatgctcgtggaaccgaagaaggcctga

DBGET integrated database retrieval system