KEGG   Ochrobactrum anthropi: Oant_4509Help
Entry
Oant_4509         CDS       T00568                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
oan  Ochrobactrum anthropi
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:oan00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pOANT01:complement(47788..48759)
Genome map
AA seq 323 aa AA seqDB search
MPLTIPAKAEHRTFLYSEPCLDLDALSADIAYLGIPYGASYTFGEIANDQSRGALAMRRA
TDRILRSIERYDFDLGGPMYDHRPIRAVDCGDVYADPREHGDHLQRAEEVVRKIVASGAL
PIILGGDHSIPIPVIKALDTEGPITLIQLDQHLDWREEINGVTQGLSSPIRRASEMDHVG
EIFQIGLHATGSGRQEEFDAAEAYGAHLVSAYDLHDHGVEPVLDMIPDGGRYYITVDLDA
FEPGGAPGVAAPCAGGMTFLQARKLIHGLVKKGRVVGMDVVEITPATDVNQITCITAGRL
IVNLIGAAVRANYFEGRAGKSGV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttacaatccccgcaaaggccgagcaccggacgttcctgtattcggagccatgt
ctcgatctggatgcgctctctgccgatatcgcctatctgggaattccctatggggcgtcc
tacaccttcggcgaaatcgccaatgaccagagccgcggcgctttggccatgcgccgggcg
accgacagaatcctccgctcgatagagcgatacgatttcgaccttggcggcccgatgtat
gaccatcgacccattcgcgcagtcgactgcggcgatgtatatgccgatccgcgcgagcat
ggggatcatctgcagcgtgccgaggaggttgtccgcaagatcgtggcttcgggtgcgctg
ccgatcatattgggtggcgatcactctattcccataccggttatcaaggcgctcgacacg
gaggggccgatcacgctcatccagctggatcagcaccttgattggcgtgaggaaatcaac
ggcgttacgcagggcctgtccagcccgatccgccgggcatccgagatggatcatgtcggc
gagatttttcagatcgggctgcacgcaaccggcagcgggcgtcaggaagagttcgacgca
gcggaagcctatggcgcacatctcgtatcggcctatgatctgcatgatcacggtgtcgag
cctgtcctggacatgatccctgatggcggtcgctattacattacggtcgatctggatgcc
ttcgagcctgggggcgcccccggcgtcgccgcgccatgtgccggcggcatgaccttcctg
caggcgcgcaaactgatccacggtctcgtcaagaagggcagggttgtcgggatggatgtc
gtggagatcacgcctgcgaccgacgtcaatcagattacctgcataacggcggggcgcttg
atcgtgaacctgatcggcgcggcggtgcgcgccaactattttgaaggtcgcgccggcaag
agcggcgtgtga

DBGET integrated database retrieval system