KEGG   Ochrobactrum anthropi: Oant_4597Help
Entry
Oant_4597         CDS       T00568                                 

Definition
pyruvate carboxylase
Orthology
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
oan  Ochrobactrum anthropi
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Oant_4597
   01230 Biosynthesis of amino acids
    Oant_4597
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Oant_4597
   00620 Pyruvate metabolism
    Oant_4597
Enzymes [BR:oan01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Oant_4597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pOANT01:132762..136235
Genome map
AA seq 1157 aa AA seqDB search
MSITKILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLSLHRFKADESYQVGRGPHLAK
DMGPIESYLSIEEVIRVAKLSGADAIHPGYGLLSESPEFVEACNKAGITFIGPTADTMRQ
LGNKVAARNLAISVGVPVVPATDPLPDDMAEVERMAEEIGYPVMLKASWGGGGRGMRAIR
KKEDLAREVTEAKREAKAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSIQ
RRNQKVVERAPAPYLSEAQRQELASYSLKIAGATNYIGAGTVEYLMDADTGKFYFIEVNP
RIQVEHTVTEVVTGIDIVKAQIHILEGAAIGTPESGVPRQEDIRLNGHALQCRITTEDPE
HNFIPDYGRITAYRSASGFGIRLDGGTSYTGAVITRYYDPLLVKVTAWAPRPDEAINRMD
RALREFRIRGVATNLTFLEAIIGHDSFRNNTYTTRFIDSTPELFAQVKRQDRATKLLTYL
ADVTVNGHPETKGRAIPSDKAAKPIVPYIDAPTPDGTKQLLDKLGPKGFADWMRNEKRVL
VTDTTMRDGHQSLLATRVRTHDIARVASAYAKALPQLLSLECWGGATFDVSMRFLTEDPW
ERLALIREGAPNLLLQMLLRGANGVGYKNYPDNVVKYFVRQAAKGGIDLFRVFDCLNWVE
NMRVSMDAISEENKLCEAAICYTGDILNSARPKYDLKYYTNLAQELERAGAHIIAVKDMA
GLLKPAAAKVLFKALREETGLPIHFHTHDTSGIAAATVLAAVDAGVDAVDAAMDAFSGNT
SQPCLGSIVEALAGSERDTGLDTEWIRRISFYWEAVRNQYAAFESDLKGPASEVYLHEMP
GGQFTNLKEQARSLGLESRWHEVAQAYADANRMFGDIVKVTPSSKVVGDMALMMVSQDLT
VADVQNPEREVSFPESVVSMLKGDLGQSPGGWPEALQKKALKGEAPYTVRPGSLLADADL
DAERKAIETKLERKVDDFEFASYLMYPKVFTDFALTAETYGPVSVLPTHAYFYGMEDGEE
LFADIERGKTLVIVNQASSGVDDKGMVTVFFEINGQPRRIKVPDRTHGASGFAVRRKAEP
GNASHVGAPMPGVISRVFVNQGQEVKAGDVLLSIEAMKMETALHAERDGKIAEVLVRPGD
QIDAKDLLVIFVIQPQN
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcacgaaaatacttgttgccaaccgatccgaaattgcgatccgcgttttccgg
gcagccaacgagctcgggattaaaaccgttgcgatttgggcggaagaggacaagctgtct
ttgcaccgcttcaaagcggacgagtcctatcaggtcggcagggggccgcatctcgccaag
gatatgggaccgatcgagagctatctttcgatcgaggaggtgatccgcgttgcgaagctc
tccggagcggacgcgattcatcccggttacggtcttctgtctgaaagccccgaattcgtg
gaggcctgcaacaaggcgggcatcaccttcatcggaccgacggcggatacgatgcgccag
ctcggcaacaaggtcgccgcccgtaatctggcgatttcggttggcgttcccgttgttccc
gccaccgacccactgccggacgacatggcggaagtggagcgtatggccgaggagatcggt
tatccggtcatgctcaaggcatcctggggcggtggtggccgtggcatgcgcgccatccgc
aaaaaggaagaccttgcccgcgaggtgacggaagccaagcgcgaggccaaggcggccttc
ggcaaggacgaagtctatctcgaaaagctggtcgagcgtgcgcgtcacgtcgaaagccag
attctcggcgacacgcacggcaatgtcgtgcatctgttcgagcgtgattgttcgatccag
cggcgtaatcaaaaggtcgtcgagcgtgcgcccgcgccctatctgagcgaagcacagcgt
caggagctcgcctcctactctctgaagattgcgggtgccacgaattatatcggtgcaggc
acggtcgaatatctgatggatgccgataccggcaaattctacttcatcgaggtcaatccg
cgcattcaggtggaacataccgttacggaagtcgtcaccggtatcgatatcgtcaaggcg
cagattcacattctggaaggcgccgccatcggcacgccggaatccggggtgccgaggcag
gaggatatccgcctgaatggccacgccctccagtgccgcattacgacggaagacccggaa
cacaatttcattccggattatggccgtatcaccgcttatcgctccgcttcaggcttcggt
atccgtctggacggcggcacgtcctatactggcgctgtcatcacccgctactacgatcct
ttgcttgtgaaggtgacggcctgggcgccgcggcccgacgaggcgatcaaccgtatggat
cgcgctttgcgcgaattccgtatccgcggcgtggcgaccaacctcacattcctggaggcc
atcatcggccatgacagttttcgcaacaatacttatacaacgcgcttcatcgattcgacg
cccgagctttttgcccaggtcaaacggcaggaccgcgctaccaagcttttgacctatctc
gctgatgtgaccgtgaacggccacccggaaaccaagggacgcgcaattccctcggacaaa
gcggcaaagccaatcgtgccttatatcgatgcgccgacgcccgacggcaccaagcagttg
ctggacaagctcggcccgaagggtttcgcagactggatgcgcaacgaaaagcgggtactc
gtcacggatacgacgatgcgcgacggacatcagtcgctgcttgcgacccgtgtccgtacc
catgatatcgcccgcgtcgccagcgcctatgccaaagcgttgccacagcttctgtcgctg
gagtgctggggcggtgcgacattcgacgtttccatgcgattcctgaccgaagacccgtgg
gagcgtctggcgctgatccgcgaaggtgctcccaacctcctgctgcagatgcttctgcgc
ggggcaaacggcgtcgggtacaagaactacccagataacgtcgtgaagtattttgtccgt
caggccgcaaagggcggcattgatcttttccgtgtcttcgattgcctcaactgggtggag
aatatgcgggtctcgatggatgccatctcggaggaaaacaagctctgtgaagcggccatc
tgctacaccggagacatcctcaattcggcccgtccgaaatacgacctgaaatattacacc
aatctcgcccaggaactggaacgcgcaggcgcgcatattattgccgtcaaggatatggcg
ggcctgctgaaaccggctgccgccaaggttctgttcaaggcgctgcgggaagaaacgggt
ctgccgatccatttccacacccatgatacgtcaggaattgcggcagcgacggttcttgcc
gccgtggatgcgggtgtcgacgcggtcgatgccgcgatggacgccttctctggcaatacg
tcgcagccgtgccttggttcgatcgtggaagcgcttgccgggtcggaacgcgatacgggc
cttgataccgaatggattcgccgcatttccttctattgggaggccgtgcgcaaccaatat
gcggctttcgaaagcgatctcaaggggccggcgtcggaagtctatctgcacgaaatgccg
ggtggtcagttcaccaacctcaaggaacaggcgcgttcgctgggtctcgaaagccgttgg
cacgaagtggcgcaggcttatgccgatgccaacaggatgttcggcgatatcgtcaaggtg
acgccgtcttcgaaagtcgtcggtgatatggcgctgatgatggtcagccaggatctgaca
gtggccgacgtccagaatcccgagcgcgaggtctctttcccggagtccgtggtttccatg
ctcaagggcgatctcggacaatcgcctggcggttggccggaagccctgcagaaaaaagcg
ttgaagggcgaagcgccctataccgttcgtccgggttcactattggcggatgccgatctc
gatgccgaacggaaggccatcgagaccaagctggagcgcaaggtcgatgatttcgagttc
gcgtcctatctgatgtatccgaaggtattcacggatttcgcgctcaccgccgaaacctat
ggtccggtctcggtgcttcccacccatgcctatttctacggaatggaggatggcgaggaa
ctgtttgccgatatagagcgcggcaagacgctggtcatcgtcaatcaggcttcgtccggc
gttgacgacaagggcatggtgacggtgtttttcgaaatcaatggtcagccgcgccgtatc
aaggtgccggatcggacgcatggtgcttccggctttgccgtgcgccgcaaggccgaacct
ggcaacgcgtcgcatgtcggggcgccgatgccgggtgtcatcagccgcgtcttcgtcaat
caaggccaggaggtcaaggccggcgacgtgttactctccattgaggcgatgaagatggaa
acggcgcttcacgccgagcgggatggcaagatcgcggaagtcctcgtgcgcccgggcgac
cagatcgatgcgaaggatttgttggtgatttttgtcatacagccgcaaaattag

DBGET integrated database retrieval system