KEGG   Ochrobactrum anthropi: Oant_4597Help
Entry
Oant_4597         CDS       T00568                                 

Definition
pyruvate carboxylase
Orthology
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
oan  Ochrobactrum anthropi
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:oan01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:oan01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:oan00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:oan00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pOANT01:132762..136235
Genome map
AA seq 1157 aa AA seqDB search
MSITKILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLSLHRFKADESYQVGRGPHLAK
DMGPIESYLSIEEVIRVAKLSGADAIHPGYGLLSESPEFVEACNKAGITFIGPTADTMRQ
LGNKVAARNLAISVGVPVVPATDPLPDDMAEVERMAEEIGYPVMLKASWGGGGRGMRAIR
KKEDLAREVTEAKREAKAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSIQ
RRNQKVVERAPAPYLSEAQRQELASYSLKIAGATNYIGAGTVEYLMDADTGKFYFIEVNP
RIQVEHTVTEVVTGIDIVKAQIHILEGAAIGTPESGVPRQEDIRLNGHALQCRITTEDPE
HNFIPDYGRITAYRSASGFGIRLDGGTSYTGAVITRYYDPLLVKVTAWAPRPDEAINRMD
RALREFRIRGVATNLTFLEAIIGHDSFRNNTYTTRFIDSTPELFAQVKRQDRATKLLTYL
ADVTVNGHPETKGRAIPSDKAAKPIVPYIDAPTPDGTKQLLDKLGPKGFADWMRNEKRVL
VTDTTMRDGHQSLLATRVRTHDIARVASAYAKALPQLLSLECWGGATFDVSMRFLTEDPW
ERLALIREGAPNLLLQMLLRGANGVGYKNYPDNVVKYFVRQAAKGGIDLFRVFDCLNWVE
NMRVSMDAISEENKLCEAAICYTGDILNSARPKYDLKYYTNLAQELERAGAHIIAVKDMA
GLLKPAAAKVLFKALREETGLPIHFHTHDTSGIAAATVLAAVDAGVDAVDAAMDAFSGNT
SQPCLGSIVEALAGSERDTGLDTEWIRRISFYWEAVRNQYAAFESDLKGPASEVYLHEMP
GGQFTNLKEQARSLGLESRWHEVAQAYADANRMFGDIVKVTPSSKVVGDMALMMVSQDLT
VADVQNPEREVSFPESVVSMLKGDLGQSPGGWPEALQKKALKGEAPYTVRPGSLLADADL
DAERKAIETKLERKVDDFEFASYLMYPKVFTDFALTAETYGPVSVLPTHAYFYGMEDGEE
LFADIERGKTLVIVNQASSGVDDKGMVTVFFEINGQPRRIKVPDRTHGASGFAVRRKAEP
GNASHVGAPMPGVISRVFVNQGQEVKAGDVLLSIEAMKMETALHAERDGKIAEVLVRPGD
QIDAKDLLVIFVIQPQN
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcacgaaaatacttgttgccaaccgatccgaaattgcgatccgcgttttccgg
gcagccaacgagctcgggattaaaaccgttgcgatttgggcggaagaggacaagctgtct
ttgcaccgcttcaaagcggacgagtcctatcaggtcggcagggggccgcatctcgccaag
gatatgggaccgatcgagagctatctttcgatcgaggaggtgatccgcgttgcgaagctc
tccggagcggacgcgattcatcccggttacggtcttctgtctgaaagccccgaattcgtg
gaggcctgcaacaaggcgggcatcaccttcatcggaccgacggcggatacgatgcgccag
ctcggcaacaaggtcgccgcccgtaatctggcgatttcggttggcgttcccgttgttccc
gccaccgacccactgccggacgacatggcggaagtggagcgtatggccgaggagatcggt
tatccggtcatgctcaaggcatcctggggcggtggtggccgtggcatgcgcgccatccgc
aaaaaggaagaccttgcccgcgaggtgacggaagccaagcgcgaggccaaggcggccttc
ggcaaggacgaagtctatctcgaaaagctggtcgagcgtgcgcgtcacgtcgaaagccag
attctcggcgacacgcacggcaatgtcgtgcatctgttcgagcgtgattgttcgatccag
cggcgtaatcaaaaggtcgtcgagcgtgcgcccgcgccctatctgagcgaagcacagcgt
caggagctcgcctcctactctctgaagattgcgggtgccacgaattatatcggtgcaggc
acggtcgaatatctgatggatgccgataccggcaaattctacttcatcgaggtcaatccg
cgcattcaggtggaacataccgttacggaagtcgtcaccggtatcgatatcgtcaaggcg
cagattcacattctggaaggcgccgccatcggcacgccggaatccggggtgccgaggcag
gaggatatccgcctgaatggccacgccctccagtgccgcattacgacggaagacccggaa
cacaatttcattccggattatggccgtatcaccgcttatcgctccgcttcaggcttcggt
atccgtctggacggcggcacgtcctatactggcgctgtcatcacccgctactacgatcct
ttgcttgtgaaggtgacggcctgggcgccgcggcccgacgaggcgatcaaccgtatggat
cgcgctttgcgcgaattccgtatccgcggcgtggcgaccaacctcacattcctggaggcc
atcatcggccatgacagttttcgcaacaatacttatacaacgcgcttcatcgattcgacg
cccgagctttttgcccaggtcaaacggcaggaccgcgctaccaagcttttgacctatctc
gctgatgtgaccgtgaacggccacccggaaaccaagggacgcgcaattccctcggacaaa
gcggcaaagccaatcgtgccttatatcgatgcgccgacgcccgacggcaccaagcagttg
ctggacaagctcggcccgaagggtttcgcagactggatgcgcaacgaaaagcgggtactc
gtcacggatacgacgatgcgcgacggacatcagtcgctgcttgcgacccgtgtccgtacc
catgatatcgcccgcgtcgccagcgcctatgccaaagcgttgccacagcttctgtcgctg
gagtgctggggcggtgcgacattcgacgtttccatgcgattcctgaccgaagacccgtgg
gagcgtctggcgctgatccgcgaaggtgctcccaacctcctgctgcagatgcttctgcgc
ggggcaaacggcgtcgggtacaagaactacccagataacgtcgtgaagtattttgtccgt
caggccgcaaagggcggcattgatcttttccgtgtcttcgattgcctcaactgggtggag
aatatgcgggtctcgatggatgccatctcggaggaaaacaagctctgtgaagcggccatc
tgctacaccggagacatcctcaattcggcccgtccgaaatacgacctgaaatattacacc
aatctcgcccaggaactggaacgcgcaggcgcgcatattattgccgtcaaggatatggcg
ggcctgctgaaaccggctgccgccaaggttctgttcaaggcgctgcgggaagaaacgggt
ctgccgatccatttccacacccatgatacgtcaggaattgcggcagcgacggttcttgcc
gccgtggatgcgggtgtcgacgcggtcgatgccgcgatggacgccttctctggcaatacg
tcgcagccgtgccttggttcgatcgtggaagcgcttgccgggtcggaacgcgatacgggc
cttgataccgaatggattcgccgcatttccttctattgggaggccgtgcgcaaccaatat
gcggctttcgaaagcgatctcaaggggccggcgtcggaagtctatctgcacgaaatgccg
ggtggtcagttcaccaacctcaaggaacaggcgcgttcgctgggtctcgaaagccgttgg
cacgaagtggcgcaggcttatgccgatgccaacaggatgttcggcgatatcgtcaaggtg
acgccgtcttcgaaagtcgtcggtgatatggcgctgatgatggtcagccaggatctgaca
gtggccgacgtccagaatcccgagcgcgaggtctctttcccggagtccgtggtttccatg
ctcaagggcgatctcggacaatcgcctggcggttggccggaagccctgcagaaaaaagcg
ttgaagggcgaagcgccctataccgttcgtccgggttcactattggcggatgccgatctc
gatgccgaacggaaggccatcgagaccaagctggagcgcaaggtcgatgatttcgagttc
gcgtcctatctgatgtatccgaaggtattcacggatttcgcgctcaccgccgaaacctat
ggtccggtctcggtgcttcccacccatgcctatttctacggaatggaggatggcgaggaa
ctgtttgccgatatagagcgcggcaagacgctggtcatcgtcaatcaggcttcgtccggc
gttgacgacaagggcatggtgacggtgtttttcgaaatcaatggtcagccgcgccgtatc
aaggtgccggatcggacgcatggtgcttccggctttgccgtgcgccgcaaggccgaacct
ggcaacgcgtcgcatgtcggggcgccgatgccgggtgtcatcagccgcgtcttcgtcaat
caaggccaggaggtcaaggccggcgacgtgttactctccattgaggcgatgaagatggaa
acggcgcttcacgccgagcgggatggcaagatcgcggaagtcctcgtgcgcccgggcgac
cagatcgatgcgaaggatttgttggtgatttttgtcatacagccgcaaaattag

DBGET integrated database retrieval system