KEGG   Ochrobactrum anthropi ATCC 49188: Oant_4654Help
Entry
Oant_4654         CDS       T00568                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00030  Pentose phosphate pathway
oan01100  Metabolic pathways
oan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Oant_4654
Enzymes [BR:oan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Oant_4654
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Oant_4654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABS17425
JGI: Oant4654
UniProt: A6X871
Position
pOANT03:16319..18706
Genome map
AA seq 795 aa AA seqDB search
MNNQTGAQPLTPDQLKLTDRYWRAANYLSVGQIYLMQNPMLREPLKPDHVKPRLLGHWGT
TPGLNFIYVHLNRIIKERNKDVLYVCGPGHGGPGMVANTYLEGTYTETYPDITEDVEGMQ
KLFRQFSFPGGIPSHVAPETPGSIHEGGELGYALVHAYGAAFDNPDLVVACVVGDGEAET
GPLAAAWHSNKFLNAKRDGAVLPILHLNGYKIANPTLLARMSDEDLHSLFTGYGYEPFFV
EGHEPEKMHQLMAATFDMAFDRIKTIKEQADLKSPERPRWPMIILRSPKGWTGPKVVDGK
MVENHWRSHQVPVANCRADDAHRKILEDWMRSYEPEDLFDESGKLKPELRAIAPDGEKRM
SAIPHSNGGLLRKELNTPDFRKYAVNVTEPGAVEEQTTKILGDYLRDVIRLNDEEKNFRV
FGPDETASNRLGSVFEATDRVWMAETLGSDDHLAADGRVMEVLSEHLCQGWLEGYLLTGR
HGFFSCYEAFIHIVDSMFNQHAKWLQVARELPWRKPVASLNYLLTSHVWRQDHNGFSHQD
PGFVDLVANKSADIVRVYFPPDANTLLWVGEHCLKTWNRVNVIVAGKQPSPQWLTMDEAE
KHCEAGLGKWDWAGSEDGMEPDLVMACAGDVPTMETLAATAMLREALPHLRIRVVNIVDL
MALQSPQHHPHGIADSEFDALFTTDRPVIFAYHGYPYLIHRLVYKRANHPNFHVRGFIEK
GTTTTPFDMAVMNELDRYHLAIEALHRLPLAADIAEPLITSLNEKLQKHHDYVREHGEDM
PEVHDWKWPHSGVVA
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcagactggcgcccagccgcttactccagatcagctgaaactgaccgaccgc
tattggcgtgcagccaattatctctccgtcggccagatttatctgatgcaaaatccgatg
ctgcgcgagcctttaaagcctgaccacgtcaaaccgcgtttgctgggccattgggggaca
acacccggcttgaacttcatctatgtgcatctcaaccgcattattaaagaacgcaacaag
gatgtgctctatgtttgcggtcccgggcatggtggcccgggcatggtagcgaacacctat
ctggaaggcacttatactgaaacctatcctgacattaccgaagatgttgaaggtatgcaa
aagctcttccgccagttctcgtttccgggcggtattccaagccatgtggcacccgaaact
ccgggttccatccatgagggcggcgagcttggctatgcgcttgtgcatgcttacggcgca
gcttttgacaatcccgatctcgtcgttgcctgtgtcgtaggtgatggtgaggccgaaacc
ggcccgttggcagcagcatggcattccaacaaattcctcaacgcgaagcgcgatggcgcg
gtgctgccgattcttcatctgaacggctataaaatcgccaatccgaccctgctcgcccgt
atgtcggatgaagacctgcacagtcttttcaccggctatggctatgagccatttttcgtt
gaaggccatgaaccggaaaaaatgcaccagctgatggcagcaacttttgacatggctttt
gaccgtatcaaaaccattaaagagcaggccgatcttaaatcgccggagcgtccgcgctgg
ccgatgattattctgcgcagcccgaaaggctggacaggacccaaagtggttgatggtaaa
atggtggagaaccattggcgttcccatcaggtgccggttgccaattgccgtgctgatgat
gcacaccgcaaaatcctcgaagactggatgcgcagctatgagccggaagacctgtttgac
gaaagcggtaagctcaaaccggaattacgcgcaatagcaccggatggtgaaaagcgcatg
agcgccattccgcattccaatggtggcttgctgcgtaaggaactgaacacaccggatttc
cgaaaatatgcggtcaatgtcaccgaaccgggcgcggttgaagaacagaccaccaaaatc
ctcggcgactatctgcgcgatgtcatccgcctcaatgacgaagagaaaaacttccgcgtc
ttcgggcctgatgaaaccgcctccaatcgtctgggcagtgtttttgaagcaaccgaccgt
gtctggatggctgaaactttaggcagtgacgaccatctggcggctgatggccgcgtgatg
gaagtgctgagtgaacatctgtgtcaaggttggctggaaggttatttgctgaccggacgc
catggcttcttctcctgctatgaagcttttatccatattgtggattccatgttcaaccaa
catgctaaatggttgcaagtggcacgcgaactgccatggcgcaagccggttgcatcgctt
aactatctgctgacgtctcatgtctggcgtcaagatcacaacggcttctcccatcaggat
ccgggctttgtcgatctggttgccaataagagcgctgatattgtccgtgtttatttcccg
ccggatgccaatacgctgctttgggtgggtgagcactgcctcaaaacatggaaccgcgtg
aacgtgattgtggctggcaagcagccatcaccacaatggctcaccatggatgaggcagaa
aaacattgtgaagccggtcttggcaaatgggactgggcaggcagcgaagatggcatggaa
ccagatctggtgatggcttgtgctggtgatgtgccgaccatggaaacattggccgccacc
gcaatgctgcgtgaagcattgccacatttgcgcattcgtgttgtcaatattgtcgacctg
atggcgctgcaatcaccgcagcatcacccgcatggtattgccgatagtgaatttgatgcg
cttttcaccaccgaccgtccggtgattttcgcctatcacggctatccatatctcattcac
cgtctggtttataagcgcgccaatcatccgaacttccatgtgcgtggctttatcgaaaaa
ggcacaaccacaacgccgtttgatatggctgtcatgaatgaactggatcgttatcatctg
gcaattgaagcactccaccgcctgcctttggccgctgatattgccgagcctctgatcact
tcgctcaatgagaagctgcaaaagcatcatgactatgtgcgtgaacatggcgaagacatg
ccggaagtacacgattggaaatggccgcatagcggcgttgttgcatga

DBGET integrated database retrieval system