KEGG   Octadecabacter arcticus: OA238_c18630Help
Entry
OA238_c18630      CDS       T02539                                 

Gene name
proB1
Definition
glutamate5-kinase ProB (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
oar  Octadecabacter arcticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:oar01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:oar00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1962679..1963782
Genome map
AA seq 367 aa AA seqDB search
MAALTSAKRLVVKIGSALLVDQTTGLRSDWLRSLAADVAAIRARGTDVILVSSGSIALGR
GVLGLPRTELPLEQSQAAAAVGQIRLARAYEEALAPHGITTAQVLVTLEDSEDRRRYLNS
RATMETLLSLDVTPIVNENDTVATDEIRYGDNDRLAAQVAVTIGADCLVLLSDVDGFYTD
NPNTNVAAQHYDVIDKITPEIESQAGDAGSGLSKGGMKTKLMAAKLATDAGCRMAIALGT
PLNPLKKLDDGGRCTWFTAQTNPQAARKRWIAAMKSHGDITVDDGAQTALKSGRSLLPIG
ITATAGTYQRGDPVAIVTARGERIGLGLSRYSSDEAQAIKGLRSQDVADVLGYEGRGVFI
HRDDMVI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttggcggccctaacatcggcaaaacggttggtcgtcaaaatcggatcggcattgctggtc
gatcaaacgacgggcctgcggtcggactggttgcgatcactggcagcggacgtcgcggcg
atacgggcacggggcaccgacgtgattttggtgtcttctgggtcaatcgcgctggggcgc
ggtgtgctgggtctgccgcgaacagaattgccacttgagcaatcacaagctgcggcagcg
gttgggcaaatccggcttgcgcgcgcctatgaagaagcacttgcgccgcacgggatcaca
acggcgcaagtgctcgtcacgctagaggactccgaggatcggcgccgctatctgaacagc
cgagcaacgatggaaacattgttgtcgcttgacgtgacgccaattgtgaatgagaacgat
accgttgcaacggacgaaatccgctacggcgacaatgatcgtcttgccgcacaggtcgcc
gtgacgattggcgcggattgtctggtcctgctaagcgatgtagacgggttctatactgac
aatcccaacacgaacgtcgctgcgcaacattatgatgtaattgataaaattacgcctgaa
atagaaagtcaggcgggcgatgcagggtccggtctttccaagggcggcatgaagaccaag
ttgatggcggcaaaactggcaaccgatgcaggatgtcgcatggcgattgcattaggaacg
ccgcttaatccattgaaaaagcttgacgatggtgggcgttgtacgtggttcactgcacag
acaaacccgcaggctgcacgcaaacgctggattgcagcgatgaaatctcacggggacatt
accgttgatgatggggcgcaaactgcattgaaatcgggacggtcgttactgccaatcggt
atcaccgccactgcgggcacctatcagcgcggcgatcccgtggcgattgtgacagcgcgg
ggcgaacgcattggccttgggctgtcgcggtattccagtgatgaagcgcaggccatcaaa
ggactccgcagccaagacgttgctgacgtgctaggttatgaagggcgcggcgtatttatt
catcgcgacgatatggtgatttga

DBGET integrated database retrieval system