KEGG   Octadecabacter arcticus: OA238_c18630Help
Entry
OA238_c18630      CDS       T02539                                 

Gene name
proB1
Definition
(GenBank) glutamate5-kinase ProB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
oar  Octadecabacter arcticus
Pathway
oar00330  Arginine and proline metabolism
oar00332  Carbapenem biosynthesis
oar01100  Metabolic pathways
oar01130  Biosynthesis of antibiotics
oar01230  Biosynthesis of amino acids
Module
oar_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OA238_c18630 (proB1)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    OA238_c18630 (proB1)
Enzymes [BR:oar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     OA238_c18630 (proB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGI71970
UniProt: M9RQD6
Position
1962679..1963782
Genome map
AA seq 367 aa AA seqDB search
MAALTSAKRLVVKIGSALLVDQTTGLRSDWLRSLAADVAAIRARGTDVILVSSGSIALGR
GVLGLPRTELPLEQSQAAAAVGQIRLARAYEEALAPHGITTAQVLVTLEDSEDRRRYLNS
RATMETLLSLDVTPIVNENDTVATDEIRYGDNDRLAAQVAVTIGADCLVLLSDVDGFYTD
NPNTNVAAQHYDVIDKITPEIESQAGDAGSGLSKGGMKTKLMAAKLATDAGCRMAIALGT
PLNPLKKLDDGGRCTWFTAQTNPQAARKRWIAAMKSHGDITVDDGAQTALKSGRSLLPIG
ITATAGTYQRGDPVAIVTARGERIGLGLSRYSSDEAQAIKGLRSQDVADVLGYEGRGVFI
HRDDMVI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttggcggccctaacatcggcaaaacggttggtcgtcaaaatcggatcggcattgctggtc
gatcaaacgacgggcctgcggtcggactggttgcgatcactggcagcggacgtcgcggcg
atacgggcacggggcaccgacgtgattttggtgtcttctgggtcaatcgcgctggggcgc
ggtgtgctgggtctgccgcgaacagaattgccacttgagcaatcacaagctgcggcagcg
gttgggcaaatccggcttgcgcgcgcctatgaagaagcacttgcgccgcacgggatcaca
acggcgcaagtgctcgtcacgctagaggactccgaggatcggcgccgctatctgaacagc
cgagcaacgatggaaacattgttgtcgcttgacgtgacgccaattgtgaatgagaacgat
accgttgcaacggacgaaatccgctacggcgacaatgatcgtcttgccgcacaggtcgcc
gtgacgattggcgcggattgtctggtcctgctaagcgatgtagacgggttctatactgac
aatcccaacacgaacgtcgctgcgcaacattatgatgtaattgataaaattacgcctgaa
atagaaagtcaggcgggcgatgcagggtccggtctttccaagggcggcatgaagaccaag
ttgatggcggcaaaactggcaaccgatgcaggatgtcgcatggcgattgcattaggaacg
ccgcttaatccattgaaaaagcttgacgatggtgggcgttgtacgtggttcactgcacag
acaaacccgcaggctgcacgcaaacgctggattgcagcgatgaaatctcacggggacatt
accgttgatgatggggcgcaaactgcattgaaatcgggacggtcgttactgccaatcggt
atcaccgccactgcgggcacctatcagcgcggcgatcccgtggcgattgtgacagcgcgg
ggcgaacgcattggccttgggctgtcgcggtattccagtgatgaagcgcaggccatcaaa
ggactccgcagccaagacgttgctgacgtgctaggttatgaagggcgcggcgtatttatt
catcgcgacgatatggtgatttga

DBGET integrated database retrieval system