KEGG   Octadecabacter arcticus: OA238_c21320Help
Entry
OA238_c21320      CDS       T02539                                 

Gene name
arcA
Definition
(GenBank) arginase ArcA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
oar  Octadecabacter arcticus
Pathway
oar00220  Arginine biosynthesis
oar00330  Arginine and proline metabolism
oar01100  Metabolic pathways
oar01110  Biosynthesis of secondary metabolites
oar01130  Biosynthesis of antibiotics
oar01230  Biosynthesis of amino acids
Module
oar_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    OA238_c21320 (arcA)
   00330 Arginine and proline metabolism
    OA238_c21320 (arcA)
Enzymes [BR:oar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     OA238_c21320 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGI72216
UniProt: M9RP51
Position
2243164..2244096
Genome map
AA seq 310 aa AA seqDB search
MTPQNIILIGAPVDSGKDRKGCIMGPDAFRTARLGDILTELGHSVTDLGNLTAQDTDIPE
HDHLIALPQTIGWTRTLKKAAKDAAPKGLPIFLGGDHSLALGSVTGIADYAASIDKPLFV
LWLDAHSDFHTPQTTASGNLHGTPVAYLSGQSGFDDFPIVSNPVPTENICMIGLRSVDPA
EHAALANTDVEIADMRAIDEGGIRAPLAEFLAKVEAADGLLHVSLDVDFLDPDIAPAVGT
TVPGGATLREAHLVMELLHDSARVTSLDLVELNPFMDERGKTASLLVDLTASLMGRRVFD
RPTRSFAGAV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcaaaacatcattctcatcggcgcgcccgtagacagcggcaaagaccgcaaa
ggctgtatcatggggccggacgcctttcgcacagcacgtctgggcgacatcctgacagag
ctgggccattcggtgaccgaccttggcaacctcacggcgcaagacaccgacatccccgaa
cacgaccacctgatcgccctgccccaaacaattggctggacgcgcacgttaaaaaaagcc
gccaaagacgcagcccccaaaggcctaccgatctttctggggggcgatcattccctcgcg
ctcggctctgtgactggcatagcggattacgcggctagcatcgacaagccgctgttcgtt
ctttggcttgatgcgcacagcgattttcatacaccgcaaacgacagccagcggcaacctg
cacggcacaccagtggcctatctcagtggccagagcgggtttgatgactttccaatcgtg
agcaatccggtcccgacagaaaacatctgcatgatcggcctgcgttccgtcgatcccgcc
gaacacgccgcccttgctaacacagacgtcgagatcgccgacatgcgtgccatagatgaa
ggcggcattcgcgcacccttggctgaattcctcgccaaagttgaggccgccgacggcctg
cttcacgtctcgctcgacgttgatttccttgatcccgacatcgcgcctgccgtcggcacg
acagtccccggtggcgcaaccctgcgtgaggcgcatctggtgatggaactgctgcacgac
agcgcccgcgtcacctcgctggacctggttgagctcaatccgttcatggacgaacgcggc
aaaaccgcctctcttttggtcgacctcaccgcgtcccttatgggccgccgcgtgtttgac
cgtccaacgcggtcgttcgcgggcgctgtgtga

DBGET integrated database retrieval system