KEGG   Octadecabacter arcticus: OA238_c24320Help
Entry
OA238_c24320      CDS       T02539                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
oar  Octadecabacter arcticus
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OA238_c24320
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OA238_c24320
   00650 Butanoate metabolism
    OA238_c24320
  Amino acid metabolism
   00360 Phenylalanine metabolism
    OA238_c24320
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OA238_c24320
   00622 Xylene degradation
    OA238_c24320
   00621 Dioxin degradation
    OA238_c24320
Enzymes [BR:oar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     OA238_c24320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2564973..2565905)
Genome map
AA seq 310 aa AA seqDB search
MKRHKIAIIGSGNIGTDLMIKVKRLSETLEVAGLIGIDPKSDGIARAQRLGIAVCCSGLG
DYLASEASEGVALVFDATSAGAHAQHDSILADRGIRRVDLTPAAIGPFIVPSVNLDSNLS
APNVNMVTCGGQATIPIVAAISAVAPVRYAEIIAAIASKSAGPGTRANIDEFTETTSRAI
ELVGGAEHGKAIIILNPANPPITMRDTVLCLCERANHDEIRASVLEMVAQVADYVPGYRL
KHEVQIEEVGDNAPLVLADYDMRFTGLKVSVFLEVEGAAHYLPSYAGNLDIMTSAALRTA
ERILSKGAVG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccacaaaatcgcaatcattggatcgggcaacatcggcaccgacctgatgata
aaggtcaagcgtctttcagaaacgcttgaagtcgcgggtctcatcgggatcgaccctaag
tcggatggcattgcccgtgcgcaacgtttgggcatcgccgtatgctgcagtgggcttgga
gactatcttgcctcagaggcatcggaaggtgtcgcattggtcttcgacgctacaagtgct
ggcgcccatgcccagcacgattcaatattggcagatcggggtatcaggagggttgactta
acgccggcggccatcggccctttcatcgtaccatcggtcaacctagattctaacctaagt
gcgccaaacgtcaatatggtcacctgtggtgggcaagcgacgattcctattgtcgcggcc
atatcggccgtcgcgccggtgcgctacgctgagatcatagctgccatcgcgtcgaaatct
gccgggcccggcacccgcgccaacattgatgaattcaccgagacgacgtcgagggcgatc
gaattggtaggtggcgcagagcacggcaaggcgataatcatcctcaatcccgcaaacccg
ccgattacgatgcgcgacacggttctgtgcctgtgtgaaagggcaaaccacgacgaaatc
cgagcctcagtgctcgagatggtcgcgcaggtagcagattacgttccaggctatcggctc
aaacatgaggtccagatcgaggaggtgggagacaacgcgcctttggttttggccgattat
gacatgcggtttaccggtctgaaggtcagcgtgttcctcgaggtcgagggggccgcgcac
tacctgccctcctatgcgggcaacctagacattatgacctccgccgcgctcaggacagcc
gaacggatactatcaaagggagcggtaggatga

DBGET integrated database retrieval system