KEGG   Octadecabacter arcticus: OA238_c33930Help
Entry
OA238_c33930      CDS       T02539                                 

Definition
(GenBank) metal dependent peptidase
Organism
oar  Octadecabacter arcticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3597574..3598614
Genome map
AA seq 346 aa AA seqDB search
MSKMNAELLRQLCEMPGVPGHEDRVRKLIMSEIDGLFDEVTVDPMGSLLCRRDADKPDAP
KIMLLCHMDEIGFLVSHISDKGYLYLQPVGGFDPRNLFSRRVLVCTEDGDFKGVMNPGGK
PIHISSAEDRKKIPEVGEFYVDLGLGEAAKDVIKVGDFVVMDEPFIEIGDKFVSKALDNR
IACWLGIEMMKKLGSKGRGAEIHVVFTTQEEVGLRGARTSAFKVQPDIGIGIDTTLACDT
PGVPDKDATTVQGKGFGLHVRDSSFIADKALVREIETLAIKNDIPYQRTMLAAGGQDGAA
AQQAAAGARAVGIVVGTRYIHTVTEMIHKTDLQAALDILTAYLADQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatgaacgccgaacttctccgtcaactgtgtgaaatgccaggtgtgccgggc
catgaagaccgcgtgcgcaagttgatcatgagcgagattgacggcctgtttgacgaggtc
acagtcgatccgatgggatcgctcctatgtcgccgtgacgccgacaaaccggacgcgccg
aagatcatgttgctgtgccacatggacgaaatcggctttcttgtcagccatatcagcgac
aaagggtatctgtacttgcagcctgtcggcggctttgatccgcgcaatctgttctcgcgc
cgcgtgctggtgtgcaccgaagatggcgacttcaagggcgtgatgaacccgggcggcaaa
ccgatccacatttcatcggctgaggatcgcaaaaagattcctgaggtcggggagttctac
gttgatctcggcttgggcgaggccgccaaggacgtcatcaaagtcggcgattttgtggtg
atggatgaaccgttcatcgaaatcggcgacaagtttgtgtctaaagcgctcgacaatcgg
atcgcgtgctggctcggcattgagatgatgaaaaagctcggctcaaaagggcgcggagcg
gagattcacgtggtgttcacgacacaagaagaagtcgggctgcgcggggcgcgaacgtcg
gcgttcaaggtacagccagacatcggcattggcatcgacaccacgctggcctgcgacacg
cccggcgtgcccgacaaggacgcgacaacagttcaaggcaaaggattcgggttacatgtg
cgcgacagtagcttcatcgcggacaaggcattggtgcgcgagattgaaacactcgcgatc
aagaatgacatcccctatcaacgcacgatgctggccgccggcggccaagacggggccgcc
gcacaacaggcagcagcaggtgcgcgggctgtcgggatcgtcgttggcacgcgctatatt
cacacggtcacagagatgatccacaaaacagatttgcaggcggcgttggacattttaacg
gcgtatctggccgatcagtga

DBGET integrated database retrieval system