KEGG   Octadecabacter arcticus: OA238_c33930Help
Entry
OA238_c33930      CDS       T02539                                 

Definition
metal dependent peptidase (EC:3.4.11.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
oar  Octadecabacter arcticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OA238_c33930
Enzymes [BR:oar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     OA238_c33930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3597574..3598614
Genome map
AA seq 346 aa AA seqDB search
MSKMNAELLRQLCEMPGVPGHEDRVRKLIMSEIDGLFDEVTVDPMGSLLCRRDADKPDAP
KIMLLCHMDEIGFLVSHISDKGYLYLQPVGGFDPRNLFSRRVLVCTEDGDFKGVMNPGGK
PIHISSAEDRKKIPEVGEFYVDLGLGEAAKDVIKVGDFVVMDEPFIEIGDKFVSKALDNR
IACWLGIEMMKKLGSKGRGAEIHVVFTTQEEVGLRGARTSAFKVQPDIGIGIDTTLACDT
PGVPDKDATTVQGKGFGLHVRDSSFIADKALVREIETLAIKNDIPYQRTMLAAGGQDGAA
AQQAAAGARAVGIVVGTRYIHTVTEMIHKTDLQAALDILTAYLADQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatgaacgccgaacttctccgtcaactgtgtgaaatgccaggtgtgccgggc
catgaagaccgcgtgcgcaagttgatcatgagcgagattgacggcctgtttgacgaggtc
acagtcgatccgatgggatcgctcctatgtcgccgtgacgccgacaaaccggacgcgccg
aagatcatgttgctgtgccacatggacgaaatcggctttcttgtcagccatatcagcgac
aaagggtatctgtacttgcagcctgtcggcggctttgatccgcgcaatctgttctcgcgc
cgcgtgctggtgtgcaccgaagatggcgacttcaagggcgtgatgaacccgggcggcaaa
ccgatccacatttcatcggctgaggatcgcaaaaagattcctgaggtcggggagttctac
gttgatctcggcttgggcgaggccgccaaggacgtcatcaaagtcggcgattttgtggtg
atggatgaaccgttcatcgaaatcggcgacaagtttgtgtctaaagcgctcgacaatcgg
atcgcgtgctggctcggcattgagatgatgaaaaagctcggctcaaaagggcgcggagcg
gagattcacgtggtgttcacgacacaagaagaagtcgggctgcgcggggcgcgaacgtcg
gcgttcaaggtacagccagacatcggcattggcatcgacaccacgctggcctgcgacacg
cccggcgtgcccgacaaggacgcgacaacagttcaaggcaaaggattcgggttacatgtg
cgcgacagtagcttcatcgcggacaaggcattggtgcgcgagattgaaacactcgcgatc
aagaatgacatcccctatcaacgcacgatgctggccgccggcggccaagacggggccgcc
gcacaacaggcagcagcaggtgcgcgggctgtcgggatcgtcgttggcacgcgctatatt
cacacggtcacagagatgatccacaaaacagatttgcaggcggcgttggacattttaacg
gcgtatctggccgatcagtga

DBGET integrated database retrieval system