KEGG   Octadecabacter arcticus: OA238_c34190Help
Entry
OA238_c34190      CDS       T02539                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase MalQ (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
oar  Octadecabacter arcticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OA238_c34190 (malQ)
Enzymes [BR:oar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OA238_c34190 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3635370..3637337
Genome map
AA seq 655 aa AA seqDB search
MSAPNDLSELADLCGIWHDYHGLHGNLKQTSSDTQKAFLTAIGIDVSDDSAIRASLATLR
HEIDDRWFPEEIIVQSGMASPQEFGLGANWQLRLDGSDDVIAQGQPDDHITLPPLASGVY
ALTATASGRTEIITVLAAPKHLPSLKTLTGTSKLWGLNLALYGLQSNRNTGLGDFEDLAQ
AAEIAGAQGAGFIGINPLHTMGHCDVDAISPYSPSHRGFLNTEYIALDRIPGLKTAQDLS
NFGDIKLATSVQYQAHKAAHHRSLNASYQRYVDAAPKPAKSDFATFKTKGGSDLQDFARF
EALSEIHGTQWHDWPTDPDAPPADRIDFHMWLQWVAAVQLADAQARSKAAGMPLGLYLDL
AVGSRRDGAESWCEQAAVAQGVSIGAPPDHLSPEGQNWNLTAFAPRKLKALRYRPLRAIL
AQTIRHAGIIRIDHVLGLNRSYWIPDDGSPGGYIRQPFESLIAIIKIEAERFNCAVVGED
LGLVPDGFRDTMRDHGFYGYSVLQYEKDDQGAFQKPDDIPAQVLSCFATHDTPTLRGYET
GRDIYWWEKLAWIDEHAADSLRQERAAEVDAFRGDTDFKSHIHCLLAQSNASLVAVQLDD
ILGVEDAQNLPGTIEQHPNWQRKYDILLENLSADGQLRATAQLMNDAGRRNADKG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcccaatgacctgtccgaactagccgatctgtgtggtatctggcatgattat
cacggtctgcacggcaacttgaaacaaacgtcatcggatacgcaaaaggcgttcctgacg
gccatcggaattgatgtgagcgatgacagcgccatccgcgcatcccttgccacgttgcgc
catgagattgatgatcgctggttccccgaagaaatcatcgtacaaagtggtatggcatca
ccgcaggagtttggcctaggcgcgaattggcaattgcgtttggacggatccgacgacgtg
attgcacaaggccagcccgacgatcatatcaccctgcctccacttgcatctggcgtctat
gcattgactgccacggcatctggccgcactgaaatcatcaccgtccttgcggcccccaaa
cacctgccgtcgctcaaaaccctgactggaacatcgaaactttggggcctgaacctcgcg
ctgtatgggctgcaatcgaaccggaacaccggccttggggattttgaagacctcgcgcaa
gcggcagaaatcgctggcgcacagggggctgggtttattggcatcaatccactgcacacc
atgggccattgtgacgtcgatgcgatcagcccctattccccgtcccatcgcggttttctc
aacaccgaatacatcgcgcttgatcgtattcccggattgaaaactgcacaggatttatcg
aattttggcgacatcaagctggcaacgtcagtccaatatcaggcgcataaagccgcgcac
catcgatccctgaacgcatcttatcagcgctacgtcgatgccgcgcccaagccagccaag
tccgacttcgcaaccttcaaaacgaagggcggatcagacctgcaagacttcgcacggttt
gaagcgttaagcgaaattcacggcacccagtggcacgattggccgaccgatccagacgcg
ccccctgcagatcgcatcgattttcatatgtggctgcagtgggtcgctgcggtccaattg
gccgatgcccaagcgcgcagcaaagcggctggaatgccgcttggcctgtaccttgatctt
gccgtgggatcacgacgcgacggtgccgaaagctggtgcgaacaagcggccgttgcgcaa
ggcgtgtccatcggcgcaccgccagatcacctcagcccggaggggcagaactggaacctc
acggcctttgcgccacgcaaactcaaggcccttcgatatcgcccgctgcgcgccatcctt
gcacagacaatccgccacgcgggtatcatccgcatcgatcacgtgctcggcctcaaccgc
agttactggatccccgatgatggcagcccggggggctatattcgccaaccgttcgaaagc
ctgattgcgatcatcaaaatcgaagcggagcgtttcaattgcgcagtcgtgggcgaagac
ctcggccttgtgccagacgggtttcgtgacacgatgcgcgaccatgggttctacggctat
tccgtgctgcaatacgaaaaagacgaccaaggcgcgttccagaaacccgacgacattcca
gcgcaagtcctgtcatgttttgccacccacgacacgccgacgcttcggggatatgagacg
ggtcgcgatatttactggtgggaaaaactggcgtggatcgacgaacatgcggccgattca
ttgcgtcaggagcgcgccgccgaagtagatgcatttcgcggcgacaccgattttaagtcc
cacatccactgtcttcttgcgcaatctaatgccagtctcgtggccgtccagcttgacgat
attcttggtgtggaagacgcccagaacctgcccggaacgattgagcaacatcctaactgg
cagcgaaaatatgacatactattggaaaatttgtcggcggacggacagcttagggccacg
gcccagttgatgaacgacgcaggcaggcgcaacgcggacaaaggatag

DBGET integrated database retrieval system