KEGG   Octadecabacter arcticus: OA238_c34250Help
Entry
OA238_c34250      CDS       T02539                                 

Gene name
proB2
Definition
glutamate5-kinase ProB (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
oar  Octadecabacter arcticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:oar01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:oar00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3644211..3645371
Genome map
AA seq 386 aa AA seqDB search
MPKKKKIVVKIGSSLLANSDRLTLRYAFMNGLMSDLAQLQKEGYDIILTSSGSVALGLNM
IGKRPEDAGIMDKQAAAACGQPLLMNAYRQVASEHGMDVGQMLVTVDDMEERRRFLNIKN
TMSRLFESDIMPIINENDSVATHDLRVGDNDRLSAKVAQMIEADVLIILTSVEGLYDRDP
SDPDAKFIAEIKDVSEHLESTTGVSALGSGGMLTKMQAASMAQNAGVETIIADGIIERPV
SSVLKNERRYTRCLVTGKTASPLKVWLSNRLQVAGTLVVSTEVAASVIAGECGITRQDVI
SIQGDFSKGDVLHVYDEDGTEVARGLTNFSSEETMLMARHIDMPIEDVIGYKTKSDVIAA
ANMLVLEENHLLLDALEEDQRVVVPL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaagaagaaaaagatcgtcgtcaagatcggttccagcctattggcaaacagtgac
aggctgacgcttcgatatgccttcatgaacgggttgatgagcgacctcgcccagctgcaa
aaagaaggttacgacatcatcctcacatcctccggttcggtggctttggggttgaatatg
attggcaaacgccccgaggatgcgggcattatggacaagcaagcggcggcagcctgtggt
cagccactgctgatgaatgcctaccgtcaagtcgcgtcagaacacgggatggatgtcggc
caaatgcttgtgaccgtcgacgacatggaagaaagacgtcgctttttgaacatcaaaaac
acgatgtcgcggttgttcgaaagcgacattatgccgatcatcaacgagaacgattccgtt
gccacccacgacttgcgtgtgggcgataacgaccgcctttccgcaaaagtggcccagatg
attgaggccgatgtattgatcattttgaccagtgtggaagggttatacgaccgcgatcca
tcagatccggacgcaaagttcattgcggaaattaaagacgtcagcgagcatctagaatca
accacgggcgtaagcgccctcggcagcggtggcatgttgaccaagatgcaggccgcaagc
atggcacagaatgcaggggtagaaacgatcatcgcagacgggatcattgaacgtccagtt
tcgtctgtcctcaagaacgaacgccgctatacgcggtgccttgtgacgggtaaaacggca
tccccgctcaaagtctggctcagcaatcggttgcaggtcgctggcacgctcgttgtctca
accgaagtggcggcatccgtgattgccggtgaatgcggcatcacccgacaggacgtgatt
tcgatccaaggtgatttcagcaagggcgacgtgctgcacgtctatgacgaagacggaacg
gaagtggcccgtggcctgacaaacttctcgtctgaggaaacgatgctgatggcgcgtcac
atcgatatgccgattgaggacgttatcggctacaaaacgaaaagcgatgtcatcgctgct
gcaaacatgctggtcttagaagaaaaccacctgctcttggatgcactagaagaagaccag
cgcgttgttgtacctctgtag

DBGET integrated database retrieval system