KEGG   Octadecabacter arcticus: OA238_c35990Help
Entry
OA238_c35990      CDS       T02539                                 

Gene name
rafA
Definition
alpha-galactosidase RafA (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
oar  Octadecabacter arcticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    OA238_c35990 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    OA238_c35990 (rafA)
   00600 Sphingolipid metabolism
    OA238_c35990 (rafA)
Enzymes [BR:oar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     OA238_c35990 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3839688..3841766
Genome map
AA seq 692 aa AA seqDB search
MKTWRLDDGRQTLVLAATRERLPEVVYWGAMLPKDEDLSAVHAANAIDVTGGMLDENPDL
SLCPEASRTFPGQPGLIVRRKDGTPLLPKFHFASAENEKGLILKYRDSDNGLTLMFEFET
DPDTYIIRAKTTLQADAPVHLHWLAAPVMPAPQLSDEMIDFSGRWCREFETNRTPWSPGI
RYRENRTGRTGHEHFPGLIVPCVGATNTHGEAYGFHYGWSGGHRMVAEELPDGRRQIQWG
HAARMEPEAATQFSTAPLYMTYSDTGLNGCAVSFQRHVRDRIVTWPKPKNPRPVHYNCWE
AVYFDHKLDVLTDIANRAAALGAERFVLDDGWFGNRDDDTRALSDWEVDVRKYPDGLTPL
IDHVRGLGMSFGIWFEPEMINPDSDIHRAHPDWALGSEDQTLGRQQKALNMALPEVRNFI
YTRMAAILAGHDIDYIKWDHNRVLPMPDAAQTRGSYELIDRLRDAFPDVDIESCASGGGR
IDFGILKRTQRVWLSDSNDALERLHIQHNAALFLPLSITGSHVGPRRCHTSGRTLDISFR
AWVAAQRHMGFEMDPRELDDHEIAVLTEVTSWWKHNRDWMENADILRLDSPDPAIIAEQQ
MPPSGERFVVFAGKAATSTQIAPRPLRLTSLAPTAMYDVSLINRTSAPTLSRGTPALKEG
ATKLSGAYLMHHGLTLPWSFPETMWVLEGHRV
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatggcgattggatgatggccgtcagacactggttctggctgcaacgcgcgag
cgtttgccagaagtggtctattggggcgcaatgctgcccaaggacgaagacctgtccgcg
gtgcacgcggccaatgccattgatgttacaggtggcatgttggatgaaaatccggacctg
tcgctgtgtcctgaggcatcgcgcaccttccccggtcaacccggcctgatcgtgcgccgt
aaagacggcacgccgttgctaccaaaattccatttcgcatcggccgagaacgaaaaaggc
ctgatcctgaaataccgcgactccgacaacggtttgaccctgatgtttgaatttgaaacc
gatccagacacctacatcattcgcgccaagacaacccttcaggccgatgcgcccgtgcat
ctgcactggcttgccgcccctgtgatgcctgcaccgcaactgtcggatgaaatgattgat
ttttcaggccgctggtgtcgtgaatttgaaacgaaccgcacgccgtggtcccccggcatc
cgttatcgtgaaaaccgcacagggcgcaccggacacgagcatttccccggtctaatcgtg
ccttgcgttggcgcaaccaatacccacggcgaagcctacgggtttcattacggctggtcg
ggcgggcaccgcatggtcgccgaagaactgcccgatggccgccgccaaatccaatggggc
cacgcggcccgcatggaaccagaagccgcgacgcaattcagcacagcgccgctatacatg
acctattccgacaccggcctgaacggctgtgctgtgtcgtttcagcgccacgtgcgggac
cgcattgtcacgtggcctaaacccaagaacccgcgccccgtgcattacaactgctgggaa
gctgtctatttcgatcacaaacttgacgtgctgacagacatcgccaaccgcgccgcagcc
cttggcgcggaacgcttcgtgctcgacgatggctggtttggcaaccgcgacgatgacacc
cgcgcgctgtctgattgggaagtcgatgtacgcaaataccccgacggtctgacgccgctc
attgatcatgtgcgcgggcttggcatgtcgttcggcatctggtttgaacccgaaatgatc
aaccccgacagcgacatccaccgcgcccaccccgattgggcactgggcagcgaagaccag
acgctgggccgtcagcaaaaggccctcaacatggccctgccagaggtgcgcaatttcatc
tacacccgcatggctgcgatccttgcaggccacgacatcgactacatcaagtgggaccac
aaccgcgtgctgccgatgcccgacgcggcacaaacccgcgggtcatacgagctgattgac
cgtctgcgcgacgcattccccgatgtggatattgaaagctgtgcgtcgggcggcgggcgc
attgatttcggcatcctgaaacgcacacaacgcgtctggctgtcagacagcaacgacgcg
ctcgaacggctgcacatccaacacaacgcagccctgttcttgcccttgtcgatcaccgga
tcgcatgtgggtccgcgccgctgtcacacctccggccgtacgctcgacatttcgtttcgc
gcctgggtcgcagcacagcggcatatggggttcgaaatggacccgcgtgaactggatgac
catgaaatcgctgttttgacagaagtcaccagctggtggaaacacaaccgcgactggatg
gaaaacgccgacatattgcgcctcgacagccccgatccggcaattatcgcagaacagcag
atgccaccgagcggcgaacggttcgtcgttttcgcaggcaaagccgcaacatctacgcaa
atcgccccgcgtccgctgcgcctgacaagtctggccccgaccgccatgtacgacgtgtcc
ctgatcaaccgcacatcggccccgaccctgtcacgcggcacgcccgcgctgaaagaaggc
gccaccaaactttccggcgcctacctgatgcatcacggtctcaccttgccatggtccttc
ccagagaccatgtgggtcttggaaggacatcgcgtatga

DBGET integrated database retrieval system