KEGG   Octadecabacter arcticus: OA238_c40960Help
Entry
OA238_c40960      CDS       T02539                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oar  Octadecabacter arcticus
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OA238_c40960 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    OA238_c40960 (thlA)
   00640 Propanoate metabolism
    OA238_c40960 (thlA)
   00650 Butanoate metabolism
    OA238_c40960 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    OA238_c40960 (thlA)
   00072 Synthesis and degradation of ketone bodies
    OA238_c40960 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OA238_c40960 (thlA)
   00310 Lysine degradation
    OA238_c40960 (thlA)
   00380 Tryptophan metabolism
    OA238_c40960 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OA238_c40960 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OA238_c40960 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OA238_c40960 (thlA)
Enzymes [BR:oar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OA238_c40960 (thlA)
Exosome [BR:oar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OA238_c40960 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4340715..4341725)
Genome map
AA seq 336 aa AA seqDB search
MGCVLPAGLGQAPARQAGFLAGLCENVPATTLNKMCGSGMKAAMIGFDQITLGQTQRMLV
GGMESMSNAPYLLPKMRDGARIGHGTLIDSMFLDGLEDAYDTGRLMGSFAEDCAQSYQFT
REAQDEYALRSLKRALSAQTSGAFDAEITPVEVAGRAAQTTVSVDEQPANARPDKIPLLK
PAFREGGTVTAANSSSISDGAAALLLTTDKTDLPIRAYIRGHASHAQAPNLFTTAPVPAA
QKLLDQLGWDKNSVDLWEVNEAFAVVPMAFMREMDLPPDIVNINGGACALGHPIGASGAR
IIVTLLHALETHNLKRGIAAICIGGGEGTAIAIERP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgtattgcctgcgggattgggccaagcaccagcgcgtcaagcagggttcttg
gcaggtctttgcgaaaacgtccccgcgacgacgctgaacaagatgtgtggatcagggatg
aaggcggcgatgatcgggtttgatcaaatcacgctgggacaaacgcagcgcatgctggtc
ggcggaatggaaagcatgagtaatgcgccgtacttgctgccaaagatgcgggacggcgcg
cggattggccatggaacattgatagattcgatgtttctggacgggttggaagacgcctat
gacacggggcgcttgatggggagtttcgcagaggactgcgcgcagagctatcagtttacc
cgtgaggcgcaggatgagtatgcgctgcgatctctgaagcgggcgttatcggcgcaaacg
tcgggggcatttgatgctgagatcacgcccgtagaggtggcaggccgagcggcgcaaacc
acggtgtcggtcgacgaacagcccgcaaacgcgcggccagataagatacctttgttaaag
cctgcgtttcgtgagggcggcacggtaacggcggccaacagttccagcatttcggatggg
gcggcggccctacttttgacaacggataaaactgatctgccaatccgcgcctacattcgc
ggccacgccagtcacgcccaagcgccaaacctgtttacaactgcgcctgttccggcggcg
caaaaactgctcgaccaacttgggtgggacaagaacagtgtcgatttgtgggaggtcaat
gaggccttcgcggttgttccaatggcgttcatgcgcgagatggatttgccgcctgacatc
gtcaatatcaatggcggcgcttgcgcgctcgggcatccgattggcgcgtccggtgcgcgg
attattgtgaccttgctgcatgctttggaaacccacaatctaaaacgtggcatagccgcg
atctgcattgggggtggcgaagggacggcgattgcgattgaacgcccttag

DBGET integrated database retrieval system