KEGG   Octadecabacter arcticus: OA238_c41670Help
Entry
OA238_c41670      CDS       T02539                                 

Definition
uroporophyrinogen-III synthase HemD-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
oar  Octadecabacter arcticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OA238_c41670
Enzymes [BR:oar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OA238_c41670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4419734..4420423)
Genome map
AA seq 229 aa AA seqDB search
MPRFDNPIVIVTRPKADAQRFIDVLRTISGPFSVIISPAFENETLSAEIPDFDTAIFTSR
AGVAQAPRGDGRSAFCVGDATATAAKGAGYAAMSADGSADDLVTLILRQRRDVALLHIRG
EISRGGIAKRLNDAGLKCHEVVAYRKAAKGPSQPIRDALSVSQNIIFPLFSAETVSILET
WPLNFEGCTVVAISDVVADASATLLPLNVVVSPAPNVHAMAQATARLIA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcttcgacaatccaatcgttatagtgaccagaccaaaggccgacgcgcagcga
ttcattgacgttcttcgcacgatatcgggcccgttcagcgtgattatcagccccgctttt
gaaaatgagacactttctgctgaaataccggacttcgacaccgcaattttcacctcccga
gcgggcgtcgcgcaagcgccacgcggcgatgggcggtcggcattttgtgtcggtgatgca
acggcaactgctgcaaagggtgcgggttacgctgccatgagcgcagatgggtctgctgat
gatttggtgacgctgattctaaggcagcgacgcgatgtcgcgttacttcatatacggggc
gaaatctcgcgtggtggcattgccaaaagactgaacgatgcgggtttgaagtgccatgaa
gtggtcgcgtatcgcaaagcggcgaaaggcccatctcaaccaattcgcgatgcgctctcg
gttagccagaatatcatttttccattgttttccgcagaaacagtatcgattctagaaaca
tggccgctaaattttgaaggctgcactgtcgtcgctataagtgacgtggtggccgatgca
tctgcaactctgttgccgctaaatgttgtggtgtcgcccgctcctaacgttcacgcaatg
gcgcaagcgacggcgcgtttgattgcttga

DBGET integrated database retrieval system