KEGG   Octadecabacter arcticus: OA238_c42670Help
Entry
OA238_c42670      CDS       T02539                                 

Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oar  Octadecabacter arcticus
Pathway
oar00071  Fatty acid degradation
oar00072  Synthesis and degradation of ketone bodies
oar00280  Valine, leucine and isoleucine degradation
oar00310  Lysine degradation
oar00362  Benzoate degradation
oar00380  Tryptophan metabolism
oar00620  Pyruvate metabolism
oar00630  Glyoxylate and dicarboxylate metabolism
oar00640  Propanoate metabolism
oar00650  Butanoate metabolism
oar00900  Terpenoid backbone biosynthesis
oar01100  Metabolic pathways
oar01110  Biosynthesis of secondary metabolites
oar01120  Microbial metabolism in diverse environments
oar01130  Biosynthesis of antibiotics
oar01200  Carbon metabolism
oar01212  Fatty acid metabolism
oar02020  Two-component system
Module
oar_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OA238_c42670
   00630 Glyoxylate and dicarboxylate metabolism
    OA238_c42670
   00640 Propanoate metabolism
    OA238_c42670
   00650 Butanoate metabolism
    OA238_c42670
  Lipid metabolism
   00071 Fatty acid degradation
    OA238_c42670
   00072 Synthesis and degradation of ketone bodies
    OA238_c42670
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OA238_c42670
   00310 Lysine degradation
    OA238_c42670
   00380 Tryptophan metabolism
    OA238_c42670
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OA238_c42670
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OA238_c42670
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OA238_c42670
Enzymes [BR:oar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OA238_c42670
Exosome [BR:oar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OA238_c42670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI74173
UniProt: M9RR10
Position
complement(4528837..4530000)
Genome map
AA seq 387 aa AA seqDB search
MSASVLLAARRSAVVPRGGALSNLSLEELAKPVLEQAIEDAQIRMEQVDEVILANALGGG
GNPARIVALNVGLSESVAGLTIDRQCSGGLDAITLADALIRSGSHQVVIAGGVESYSRRP
LRYRTFHDDRVAEQYDQAQFTPWPDRDPDMAVAADQLASKYGISKAEQDAWAIESHRKAI
ASQSTHSTARIVEVAGVTKDAFPRNLSMALCNRASSVSGSISVANMAVAADCAAVVVMTS
ADFAEQHGLQGLKFISGISVGAQPDMPGEAPIMAIKTLLKRTGIAAEDLSHIEIMEAFAV
QALVCQRGAQLPLNLVNLEGGSLARGHPIGASGAILAVNIFDELTQRPGFGLAAIAAAGG
IGSAALFGALSKQNRWSRAGRGISVAG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcgtcggtcctcttagcagcccgccgcagcgcggttgtaccacgtggaggcgca
ttgtctaacctgtcgcttgaagaattggcaaaaccagttctggagcaagctatcgaagat
gcccagattagaatggaacaggtcgatgaggtcatccttgccaacgcccttggtggggga
gggaacccggcacgtattgtcgcgttgaacgtggggttatctgaatccgtcgccggtctc
acaattgatcgacaatgctcaggaggtcttgatgcgattacgctcgctgatgccttaatc
agatcgggaagccatcaggtggtcatcgctggtggagtagagagttattcgcgaaggcct
ttgcggtatcggacgtttcatgatgatcgggtggcagaacaatacgatcaggctcagttc
acgccttggcccgaccgagatcctgatatggcggttgcagctgaccaacttgcttccaaa
tatgggatatccaaagccgaacaagatgcttgggcaatagagagtcatcgaaaagcaata
gcttcacaatcaacccactctactgctcggatcgtagaagtcgcaggagtgactaaagat
gcattcccgcgaaatcttagcatggcgctgtgcaatcgagcatcgtctgtaagcgggagt
atttcggtcgcgaacatggctgtcgctgcagattgcgccgcggtagttgtcatgacttcg
gcagacttcgccgaacaacatggcctacaaggtctaaaatttatttctggtatcagcgtt
ggcgcacagccagacatgccgggtgaagcccccataatggctataaaaacactgcttaag
cgaactggaatcgcggcagaggacctcagccatatagagataatggaggctttcgcagta
caggcgttggtttgccagcgaggcgcacagttgccactgaacttggtcaacttagagggg
ggatctctagctcgggggcatcccattggcgcttcgggagccattttggctgtgaacatc
tttgatgaactaacacaaagaccaggtttcggacttgcggcaattgctgctgctggtgga
attggtagcgccgctctatttggtgcactatcaaagcaaaatcggtggagccgggcaggg
cgcggaattagcgtcgcaggatga

DBGET integrated database retrieval system