KEGG   Octadecabacter arcticus: OA238_c44370Help
Entry
OA238_c44370      CDS       T02539                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
oar  Octadecabacter arcticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:oar00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OA238_c44370
Enzymes [BR:oar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OA238_c44370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4722156..4723022
Genome map
AA seq 288 aa AA seqDB search
MTIWNLGSINADIVYSVPHIPSPGETLASTGRAVFLGGKGANMSVAAARAAARVAHIGAV
GADGRWAVERLLEYGVDTRHIVEIDVETAQAIIAVDTNGENIIILHQGANVKIPTHVLEQ
ALTQAETGDALVFQNETNLQVQAASLAAKMGLRVAYAAAPFDSGAVMAVLPYLDFLILNE
VEAAQLKDTTGQGPQDIPVKDVIVTLGAKGATWFGPDGPINVPAHKVTPIDTTGAGDTFT
GYVLAGLDRGQPMLQAMQMASKAAAIMVMRRGTADVIPDLADVQSFSD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctggaacttaggctccattaatgcggatattgtctattcggttccgcacatc
cccagccctggtgaaacgcttgccagcacaggccgcgcagtttttctgggcggtaaaggt
gcaaacatgtccgttgccgccgcccgcgccgccgcccgtgttgcccacatcggcgcagtt
ggcgccgatgggcgctgggccgttgaacggctgctggaatacggtgttgatacacgccat
atcgttgaaatcgatgttgaaacagcgcaagcgattattgcggttgatacaaatggcgaa
aacatcatcattttgcaccaaggggccaacgtcaaaatccctacccacgtgttagaacag
gcactaacgcaggccgaaaccggtgatgcattggtttttcagaacgaaaccaacctgcaa
gtgcaagccgcctcactcgccgcaaagatgggtctgcgcgtggcctatgccgccgcaccg
tttgactctggcgcggtgatggcggtgctcccttaccttgattttctgatcctgaacgaa
gtcgaagccgcgcagttaaaagacacgactggacaaggcccgcaagatattcccgtcaaa
gacgtcattgtcacgctcggcgcaaagggtgccacttggtttggccccgacggtccgatc
aatgttcctgcccacaaagtgacgcccatagataccactggcgccggtgataccttcacg
ggctacgttcttgcgggtcttgatcggggccaacccatgttgcaagccatgcaaatggcg
tccaaagcagccgcaatcatggtcatgcgacggggtaccgccgacgtgatacctgattta
gcggatgttcaatcctttagtgattga

DBGET integrated database retrieval system