KEGG   Ovis aries (sheep): 101106539Help
Entry
101106539         CDS       T03117                                 

Gene name
ABHD12
Definition
(RefSeq) LOW QUALITY PROTEIN: monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
oas  Ovis aries (sheep)
Brite
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101106539 (ABHD12)
Peptidases [BR:oas01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101106539 (ABHD12)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101106539 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
13
AA seq 398 aa AA seqDB search
MRKRTEPVALEHERRAASGSPSAGPAAAALDXDCRLKQNLCLAGPGPAEPRCAADAGMKR
ALGRRKGLCFRLRKILFFVLGLYVAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKRPQDR
GLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALSSSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKVRSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYXYFPGFDWF
FLDPITSSGIQFANDENVKHISCSLLILHSEDDPVVPFQLGRKLYNIAAPSRSFRDFKVQ
FIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPGRQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcctgtcgccctggagcatgaacgccgtgccgcctcgggctcg
ccctccgccggcccggccgccgcggcgctggacngcgactgccgcttgaagcagaacctg
tgcctggcgggcccggggccggccgagccgcgctgcgccgcggacgcgggcatgaagcgg
gcgctgggcaggcgaaagggcctgtgcttccgactgaggaagatactcttctttgtcctg
ggattgtatgtggccattccgtttctcatcaaactatgtcctgggatacaggccaaactg
attttcttgaatttcgtgcgggttccctatttcattgatttgaaaagaccgcaggatcga
ggtttgaatcacacctgtaattactacctccagccagaggaagacgtaaccattggagtc
tggcacacggtccctgctgtctggtggaagaatgcccaggggaaggaccagatgtggtac
gaggatgccctgtcttccagccacccgatcatcctgtacctgcatgggaacgcgggcacc
agaggtggcgaccatcgggtggagctttacaaggtgctgagttccctcggctaccacgtg
gtcacctttgactacagaggttggggtgactcagtaggaacgccgtcggagcggggcatg
acgtatgatgcactccatgtttttgactggatcaaagtgcgaagtggagacaaccccgtg
tatatttgggggcattctctcggcactggagtggccacaaacctggtgcggcgcctctgt
gagcgagagactcctccagatgccctcatcttggaatctccattcactaatatccgtgaa
gaagccaagagccatccgttctcagtgatctattgatacttccctgggtttgactggttc
ttccttgatcccatcacaagcagtggaattcagtttgcaaatgatgaaaatgtgaagcac
atctcttgctccctgctcatcctgcactccgaggacgacccggtcgtgcccttccagctc
ggcagaaagctctacaacatcgccgcaccgtcacgcagcttccgggacttcaaagttcag
ttcatccccttccactcggacctcggctacaggcacaagtacatctacaagagccccgag
ctcccgcggatcctgagggagttcctggggaagtcggaaccgggacgccagcactga

DBGET integrated database retrieval system