KEGG   Ovis aries (sheep): 101109820Help
Entry
101109820         CDS       T03117                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 1
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
oas  Ovis aries (sheep)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101109820
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101109820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 309 aa AA seqDB search
MPGSRGRTLGLGAPPRLPLRHGRPQGRSLGAYLVRRSRRPPVTLLDPNEKYRLRLLDKTT
VNHNTKRFRFALPTAHHVLGLPVGKHVYLSARIDGSLVIRPYTPITSDEDQGYVDLVIKV
YLKGVHPKFPEGGKMSQYLDSLKIGDMVEFRGPSGLLTYAGKGKFNIQTNKKAPPEARVA
RNLGMIAGGTGITPMLQLIRAILKDPEDPTQCSLLFANQTEKDIILREDLEELQAQHPNR
FKLWFTLDHPPEGWAYSKGFVSADMIRERLPAPGEDTLLLLCGPPPMVQQACHPSLDKLG
YSPKMRFTY
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccggggtcccggggccgcacgctcgggctgggggccccacccaggctgcccctgcgc
cacggccggccccagggccgcagtctgggcgcctacctggtgcggaggtcccgccggccg
ccagtcacgctcctggaccccaatgagaagtaccggctgcgactgctagacaagactacc
gtgaatcacaacaccaagaggttccgctttgccctgcccacggctcaccacgttctgggg
ctgcctgtgggcaaacatgtctacctctctgcccggatcgacggcagcctggtcatcagg
ccgtacactcccatcaccagcgatgaggaccagggctacgtggatcttgtcatcaaggtc
tatctgaagggcgtgcaccccaaatttcctgagggagggaagatgtctcagtacctggat
agcctgaagattggggacatggtggagtttcgggggccaagtgggctgctcacttacgcg
ggaaaagggaagtttaacatccagaccaacaaaaaggctccaccagaagcccgcgtggcc
aggaacctgggaatgattgccggaggcacaggaatcactccaatgctgcagctgatccgg
gccatcctgaaagaccccgaagatcctacccagtgctctctgctgtttgccaatcagact
gaaaaggacataatcttacgagaggacttggaggagctgcaggcccaacaccccaaccgc
tttaagctctggttcaccctggatcaccccccagaaggttgggcctacagcaagggcttt
gtctctgcggacatgatccgggagcgcctgcccgcccccggggaggacacgctgctgctg
ctctgtggaccacccccgatggtgcagcaggcctgccaccctagcctggacaaactgggc
tactcgccgaagatgcgcttcacctactga

DBGET integrated database retrieval system