KEGG   Ovis aries (sheep): 101114312Help
Entry
101114312         CDS       T03117                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X4
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
oas  Ovis aries (sheep)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101114312 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101114312 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    101114312 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    101114312 (MGLL)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101114312 (MGLL)
Peptidases [BR:oas01002]
 Serine Peptidases
  Family S33
   101114312 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
19
AA seq 303 aa AA seqDB search
MPEERSPRLTPQNVPYRDLPHLVNADGQHLFCRYWKPSGAPRALVFVSHGAGEHCGRYEE
LAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFVRDALQHVDAVQKDHPGLPVFLLG
HSMGGAICILTAAERPGHFSGMVLISPLVVASPDSATLFKVFAAKVLNLVLPNMSLGRID
SSVLSRNKTEVDIYNSDPLVCRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAVAGAG
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaacgttcccccaggctgaccccacagaacgtcccctaccgggacctccct
cacctggtcaacgctgacggacagcacctcttctgccggtactggaaaccctcaggcgcg
cccagggcgctggtgttcgtgtcccacggggccggcgagcactgcggccgctacgaggag
ctggcgcagatgctggtggggctgggcctgctggtcttcgcccacgaccacgtcggccac
gggcagagcgaaggcgagaggatggtggtgtccgacttccacgtcttcgtccgggacgcg
ctgcagcatgtggacgccgtgcagaaggaccaccccgggctgcccgtcttccttctgggc
cactccatgggcggcgcgatctgcatcctcacggccgcggagcggccgggccacttctcg
ggtatggtcctcatctccccgctggtggtcgccagcccagactcggcgacacttttcaag
gtcttcgctgcgaaagttctgaacctcgtcctgccgaacatgtccctgggccggatcgac
tccagtgtgctctcgaggaataagacagaggtggacatctacaactcggaccccctggtc
tgccgggcggggctcaaagtctgctttggcatccagctgctcaacgcggtgtcgcgggtg
gagcgggcgctgcccaagctgacgctgcctttcctgctgctgcagggctccgccgaccgc
ctctgcgacagcagaggcgcctacctgctcatggagtcggccaagagccaggacaagaca
ctcaagatttacgaaggtgcctaccacatcctccacaaagagcttcccgaggtgaccagc
tccgtcttccgggagataaacacgtgggtctcgcaaaggacagcggtggcgggcgcaggg
tgcccgccctga

DBGET integrated database retrieval system