KEGG   Ovis aries (sheep): 443551Help
Entry
443551            CDS       T03117                                 

Gene name
PTGS1, COX-1, COX1, PGHS-1
Definition
prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) (EC:1.14.99.1)
Orthology
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
oas  Ovis aries (sheep)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    443551 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    443551 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    443551 (PTGS1)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     443551 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 600 aa AA seqDB search
MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMDTKGKKQLPDAEFLSRR
FLLRRKFIPDPQSTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagtatctcgctccgattcccgctgcttctcctgctgctgtcgccatcc
cccgtcttctcagcggaccccggggcgcccgcgccagtgaacccctgctgttactatcca
tgccagcaccaggggatctgtgttcgcttcggccttgaccgctaccaatgtgactgcacc
cgcacgggctattccggccccaactgcaccatcccggagatatggacctggctccggacg
actttgcggcccagcccctctttcatccactttctgctgacgcacgggcgctggctttgg
gattttgtcaatgccaccttcatccgggacacgctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacatagcgcacgattacatcagctgggag
tccttctccaatgtgagctattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatggacaccaaagggaagaagcaattgccagatgcggagttcctgagccgtcgc
ttcctgctcaggaggaagttcatccctgaccctcaaagcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttcttcaaaacttccggcaagatgggtcctggcttc
accaaggcgctgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaagctgaagtaccagatgctcaatggagag
gtgtacccgccatcggtggaagaggcgcccgtgctgatgcactacccccggggcatcccg
ccccagagccagatggctgtgggccaggaggtgtttgggctgcttcctggactcatgctc
tacgccacgatctggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
cccacctggggcgacgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtatgtgcagcagctgagcggctacttcctgcagctcaag
ttcgacccagagctgctgttcggggcccagttccagtaccgcaaccgcatcgccatggag
ttcaaccagctgtaccactggcacccgctcatgcccgactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcaggccggattggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatcacgggtgctaaggctg
cagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaagag
ctcacaggtgagaaggagatggcagctgaattggaggagctgtatggagacattgatgct
ttggaattctacccggggctacttcttgagaagtgccatccgaactccatctttggggag
agtatgatagaaatgggggctcctttttcccttaagggcctcttaggaaaccccatctgt
tctccagagtactggaaggcgagcacatttggcggtgaggtgggcttcaaccttgtcaag
acggccacgctaaagaagctggtttgcctcaacaccaagacttgtccctatgtctccttc
cacgtaccagacccccgtcaggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system