KEGG   Ovis aries (sheep): 443551Help
Entry
443551            CDS       T03117                                 

Gene name
PTGS1, COX-1, COX1, PGHS-1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) (EC:1.14.99.1)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
oas  Ovis aries (sheep)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    443551 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    443551 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    443551 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    443551 (PTGS1)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     443551 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 600 aa AA seqDB search
MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMDTKGKKQLPDAEFLSRR
FLLRRKFIPDPQSTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagtatctcgctccgattcccgctgcttctcctgctgctgtcgccatcc
cccgtcttctcagcggaccccggggcgcccgcgccagtgaacccctgctgttactatcca
tgccagcaccaggggatctgtgttcgcttcggccttgaccgctaccaatgtgactgcacc
cgcacgggctattccggccccaactgcaccatcccggagatatggacctggctccggacg
actttgcggcccagcccctctttcatccactttctgctgacgcacgggcgctggctttgg
gattttgtcaatgccaccttcatccgggacacgctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacatagcgcacgattacatcagctgggag
tccttctccaatgtgagctattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatggacaccaaagggaagaagcaattgccagatgcggagttcctgagccgtcgc
ttcctgctcaggaggaagttcatccctgaccctcaaagcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttcttcaaaacttccggcaagatgggtcctggcttc
accaaggcgctgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaagctgaagtaccagatgctcaatggagag
gtgtacccgccatcggtggaagaggcgcccgtgctgatgcactacccccggggcatcccg
ccccagagccagatggctgtgggccaggaggtgtttgggctgcttcctggactcatgctc
tacgccacgatctggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
cccacctggggcgacgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtatgtgcagcagctgagcggctacttcctgcagctcaag
ttcgacccagagctgctgttcggggcccagttccagtaccgcaaccgcatcgccatggag
ttcaaccagctgtaccactggcacccgctcatgcccgactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcaggccggattggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatcacgggtgctaaggctg
cagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaagag
ctcacaggtgagaaggagatggcagctgaattggaggagctgtatggagacattgatgct
ttggaattctacccggggctacttcttgagaagtgccatccgaactccatctttggggag
agtatgatagaaatgggggctcctttttcccttaagggcctcttaggaaaccccatctgt
tctccagagtactggaaggcgagcacatttggcggtgaggtgggcttcaaccttgtcaag
acggccacgctaaagaagctggtttgcctcaacaccaagacttgtccctatgtctccttc
cacgtaccagacccccgtcaggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system