KEGG   Octadecabacter antarcticus: OAN307_c06110Help
Entry
OAN307_c06110     CDS       T02538                                 

Gene name
rafA
Definition
alpha-galactosidase RafA (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
oat  Octadecabacter antarcticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:oat00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:oat00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(579313..581376)
Genome map
AA seq 687 aa AA seqDB search
MDDGRQTLVLAARQDHLPEVVYWGAVLPDGEDLSALHAAHAIDVTGGMLDENPDLSLCPE
ASRTFPGQPGLIVRRQDGTPLLPKFHFASAEDGKDLSLKYHDADNGLTLTFEFETDPQTH
VIRAKTILQADAPVHLHWLAAPVMPAPQLSDEMIDFSGRWCREFETNRTPWSPGIRYREN
RTGRTGHEHFPGLIVPCIGATNTHGEAYAFHYGWSGGHRMVAEELPDGRRQIQWGHAAHM
EPEAATQFSTAPLYMTYSDTGLNGCAVSFQRHVRDRIVTWPKPKTPRPVHYNCWEAVYFD
HKLDVLTDIADRAAALGAERFVLDDGWFGNRDDDTRALSDWEVDVRKYPDGLTPLIDHVR
GLGMSFGIWFEPEMINPDSDIHRAHPDWALGSEDQTLGRQQKALNMALPEVRNFIYTRMA
AILENHDIDYIKWDHNRVLPMPDAAQTRGSYDLIDRLRDAFPDVEIESCASGGGRIDFGI
LKRTQRVWLSDSNDALERLHIQHNAALFLPLSITGSHVGPRRCHTSGRTLDISFRAWVAA
QRHMGFEMDPRELDAHEIAVLTEVTSWWKHNRTWMENADILRLDSPDPAIIAEQQMPQDG
DRFVVFAGKAATSTQIVPRPLRLTGLDPQAMYTLSLINRASAPTLSRGTPALKKGPATLS
GAYLMHHGLTLPWSFPETMWVVEGTRL
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
ttggatgatggccgccagacacttgttctggccgcgcggcaggatcatctgccagaggtt
gtgtattggggcgcggtcctgccggatggcgaagacctgtccgcgctgcatgcggcccat
gccatcgacgtcaccggtggcatgctggatgaaaaccccgacctgtcgctctgccccgag
gcatcgcgcacctttcccggtcagcctggcctgatcgtacgccgccaagacggcacgccg
ctgctgccgaaattccatttcgcatcggctgaggacggcaaagacttatccctgaaatac
cacgacgcagacaacggtttgacgctgacgtttgaatttgaaaccgatccacaaacccac
gtcatccgcgcaaaaacaatccttcaggccgacgcgcccgtgcatcttcattggctcgcc
gcaccggtgatgccagccccgcaactgtcagacgaaatgattgatttttccggccgctgg
tgtcgtgaatttgaaaccaaccgaaccccttggtcccccggtattcgctaccgcgaaaac
cgcacaggacgcacggggcatgaacatttccccggtctgatcgtgccgtgcattggcgca
accaacacacatggcgaagcctacgcattccactacggctggtccggcgggcaccgcatg
gtcgccgaagaactgcccgatggccgccgccaaatacagtggggccacgccgcacacatg
gaaccagaggccgccacccaattcagcaccgcaccgctgtacatgacctattccgacacg
ggcctgaacggctgcgccgtgtcgttccaacgccacgtgcgcgaccgcattgtcacatgg
ccaaaacccaaaacgccgcgccccgtgcattataactgctgggaagcggtctattttgat
cacaaactcgacgttctgactgacatcgccgaccgcgccgcagcccttggcgccgaacgt
ttcgtgctggatgacggctggtttggcaaccgcgacgacgacacccgcgcgctgtctgat
tgggaagtcgatgtgcgcaaataccccgacggtctgaccccgcttattgaccacgtacgc
gggcttggcatgtcgttcggcatctggtttgaacccgaaatgatcaaccccgacagcgac
atccaccgcgcccatcccgattgggcactgggcagtgaagatcagacattgggccgtcag
caaaaggcccttaatatggccctgccagaggtgcgtaattttatctacacccgcatggcc
gcgatccttgaaaaccacgacatcgactacatcaaatgggaccacaaccgcgtgttgccg
atgcccgatgcggcgcaaacgcgcgggtcatacgacctcattgaccgtctgcgcgacgca
tttcctgatgtggaaatcgaaagctgtgcgtcgggcggtgggcgcattgatttcggcatc
ctgaaacgcacacaacgggtctggctgtccgacagcaatgacgcgctcgaacgcctgcac
attcaacacaacgccgcgcttttcctgcccctgtcgatcactggatcgcacgtcgggccg
cgccgctgccacacctctggccgcacactcgatatttcatttcgcgcatgggtcgcagca
cagcgccacatggggttcgaaatggacccgcgtgaactcgacgcccacgaaatcgcggtg
ctgacagaagtcaccagctggtggaaacacaatcgcacttggatggaaaacgccgatatc
ttacgcctcgacagcccagatccggcgatcatcgcagaacagcaaatgccgcaagacggc
gaccgcttcgtggttttcgcaggcaaggccgcaacatcgacgcaaatcgtcccacgtccg
ctgcgcctaacaggtctggacccgcaagccatgtacaccctgtccctgatcaaccgcgca
tcggccccgaccctgtcgcgcggcacacctgccctgaaaaaaggccccgccacgctgtca
ggcgcctacctcatgcaccacggtttgaccttgccttggtcgttcccggaaaccatgtgg
gttgttgaagggacacgcttatga

DBGET integrated database retrieval system