KEGG   Octadecabacter antarcticus: OAN307_c07960Help
Entry
OAN307_c07960     CDS       T02538                                 

Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oat  Octadecabacter antarcticus
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OAN307_c07960
   00630 Glyoxylate and dicarboxylate metabolism
    OAN307_c07960
   00640 Propanoate metabolism
    OAN307_c07960
   00650 Butanoate metabolism
    OAN307_c07960
  Lipid metabolism
   00071 Fatty acid degradation
    OAN307_c07960
   00072 Synthesis and degradation of ketone bodies
    OAN307_c07960
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OAN307_c07960
   00310 Lysine degradation
    OAN307_c07960
   00380 Tryptophan metabolism
    OAN307_c07960
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OAN307_c07960
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OAN307_c07960
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OAN307_c07960
Enzymes [BR:oat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OAN307_c07960
Exosome [BR:oat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OAN307_c07960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
770072..771214
Genome map
AA seq 380 aa AA seqDB search
MSASVLLAARRSAVVPRGGALSRLSLEELAKPVLEQAIEDAQIRMEQVDEVILANALGGG
GNPARIVALNVGLSESVAGLTIDRQCSGGLDAITLADALIRSGSHQVVIAGGVESYSRRP
LRYRTFYGDRVAEQYDQAQFTPWPDRDPDMAVAADHLASKYGISKAEQDAWAIESHRKAI
ASQSTHSTARIVEVAGVTKDAFPRNLSMALCNRASSVSGSISVANMAVAADCAAVVVMTS
ADFAEQHGLQGLKFISGISVGAQPDMPGEAPIMAIKTLLKRTGIAAEDLSHIEIMEAFAV
QALVCQQGAQLPLNLVNLEGGSLARGHPIGASGAILAVNIFDELTQRPGFGLAAIAAAGG
IGSAALFGALSEKNRLRRAR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcgtcggtcctcttagcagcgcgccgcagcgcggttgtaccacgtggaggcgca
ttgtctcgcctgtcgcttgaagaattggcaaaaccagttctggagcaagctatcgaagat
gcccagattagaatggaacaggtcgatgaggtcatccttgccaacgcccttggtggggga
gggaacccggcacgtattgtcgcgttgaacgtggggttatctgaatccgtcgccggtctc
acaattgatcgacaatgctcaggaggtcttgatgcgattacgctcgctgatgccttaatc
agatcgggaagccatcaggtggtcatcgctggtggagtagagagttattcgcgaaggcct
ttgcggtaccggacgttttatggtgatcgggtggcagaacaatacgatcaggctcagttc
acgccttggcccgaccgagatcctgatatggcggttgcagccgaccaccttgcttccaaa
tatgggatatccaaagccgaacaagatgcttgggcaatagagagtcatcgaaaagcaata
gcttcacaatcaacccactctactgctcggatcgtagaagtcgcaggagtgactaaagat
gcattcccgcgaaatcttagcatggcgctgtgcaatcgagcatcgtctgtaagcgggagt
atttcggtcgcgaacatggctgtcgctgcagattgcgccgcggtagttgtcatgacttcg
gcagacttcgccgaacaacatggcctacaaggtctgaaatttatttctggtatcagcgtt
ggcgcacagccagacatgccgggtgaagcccccataatggctataaaaacactgcttaag
cgaactggaatcgcggcagaggacctcagccatatagagataatggaggctttcgcagta
caggcgttggtttgccagcaaggcgcacagttgccactgaacttggtcaacttagagggg
ggatctctagctcgggggcatcccattggcgcttcgggagccattttggctgtgaacatc
tttgatgaactaacacaaagaccaggtttcggacttgcggcaattgctgctgctggtgga
attggtagcgccgctctatttggtgcactatcagagaaaaatcggttgaggcgggcacgg
tga

DBGET integrated database retrieval system