KEGG   Octadecabacter antarcticus: OAN307_c09560Help
Entry
OAN307_c09560     CDS       T02538                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase MalQ (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
oat  Octadecabacter antarcticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OAN307_c09560 (malQ)
Enzymes [BR:oat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OAN307_c09560 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(939213..941180)
Genome map
AA seq 655 aa AA seqDB search
MNVQNDLSELADLCGIWHDFHDLHGNLKQTSPDTQKAFLTAIGLDVSNGDAIAASLATLR
HEIEDRWFPEEIIVQSDVQAAQVFGLGAVWQLRLDGSNDVIAQGQPSDYITLPPLASGVY
VLTATASGRTEIITVLAAPKHLSSVEILTERSKLWGLNLALYGLQSDRNTGLGDFEDLAQ
AAEIAGKMGAGFIGINPLHTMGHCDVNAISPYSPSHRGFLHTGYIALDRIPGLNTAPSIS
DFSDIKLASSVQYKAHKILHHQSLEASFQRFTDTAPNPAKSDFEIFKINSGSDLQDFARF
EALSEIHGTQWHDWPTDPNAPPTIRLDFHMWLQWVAAVQLADAQTRSKAAGMPLGLYLDL
AVGSRRDGAESWCEQAAVAQGVSIGAPPDHLSPEGQNWNLTAFAPRKLKALRYRPLRRIL
AQTIHHAGLIRIDHVLGLNRSYWIPDDGSPGGYIRQPFESLIAIIKIEAERFNCAVVGED
LGLVPDGFRDTMRAHGFYGYSVLQYEKDEQGAFQKPDNIAAQVLSCFATHDTPTLRGYEV
GRDIDWWEKLAWIDAQAADAMRQDRATQVDAFRGDSDFQASIHSLLAQSNASLVAIQLDD
ILAVEDAQNLPGTIDQHPNWRRKYDIRLDDLTADGRLGPSAQLMNDAGRHNANEG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtacaaaacgacctctctgagttggccgacctctgtggaatttggcatgatttc
cacgacctgcacggcaatctgaaacaaacctcacccgatacgcaaaaggcgtttttgaca
gccatcggccttgatgtgagcaacggtgacgcaatcgccgcgtccctcgccacgcttcgc
catgaaattgaggatcgctggttccccgaagaaatcatcgtgcaaagtgacgtacaggcg
gcgcaggtattcggacttggtgcggtttggcaattgcgtttggatggatccaacgacgtt
attgcccaaggccagcccagcgattacattaccctgccaccacttgcatctggcgtctat
gtgctgaccgcgacggcctctggtcgcacagaaatcatcaccgtccttgcggcgcccaaa
cacctatcgtcggttgagatcctgacagagagatcaaaactttggggcctcaaccttgcg
ctttatgggctgcaatcagaccgaaacacgggtcttggtgatttcgaagacctcgcgcaa
gcagcagaaattgcgggtaagatgggtgccggtttcatcggcatcaacccactgcacacg
atgggccattgcgacgtcaatgcgattagtccctattccccgtcccatcgcggatttctc
cacaccggctacattgcgcttgatcgcattccggggctgaatactgcgccgagtatatcg
gatttttccgacatcaaactggcaagttcggtccaatacaaagcgcataaaatattgcat
catcaatcacttgaagcatcttttcagcgtttcacagatacggcacccaatcccgctaaa
tcagacttcgaaatattcaaaataaacagtggatcagacctgcaagacttcgcacggttc
gaagcgttaagcgaaattcatggcacccagtggcacgattggccgaccgatccaaacgca
ccgcccacgatccgccttgattttcatatgtggctgcaatgggtcgccgcagtccaattg
gccgacgcccaaacgcgcagcaaggcggcaggaatgccgcttggcctgtaccttgatcta
gcggtgggatcacgccgtgacggtgccgaaagttggtgcgaacaagcggcggtggcgcaa
ggtgtttccatcggcgcaccgccagatcacctcagccctgaagggcaaaactggaacctg
acagcctttgcgccgcgcaaactcaaggcacttcggtatcgccccctgcggcgcatcctt
gcgcagacaattcaccacgcgggtctcattcgcattgatcacgtgcttgggcttaaccgc
agttattggattcccgatgacggcagtccggggggctatatccgccaaccgttcgaaagc
ctaatcgcgatcatcaagatcgaagcggagcgatttaattgcgcggtcgtgggcgaagac
ctcggccttgtgccagacggatttcgcgacacgatgcgcgcgcacgggttctacggttat
tccgtacttcaatacgaaaaagacgagcaaggcgcgttccagaaacccgacaatattgct
gcgcaagtcctatcctgctttgcgacccacgacaccccaacgcttcggggatatgaggta
ggtcgagacatcgattggtgggaaaaactggcctggatcgacgcgcaagcggctgatgcg
atgcgtcaggatcgtgctacgcaagtagatgcgtttcgtggtgacagcgattttcaggcc
agcatccacagtctgcttgcgcagtccaatgccagtctcgtggccatccagctcgacgat
attcttgctgttgaagacgcccagaacttacccgggacgattgatcaacatcctaactgg
cggcgaaaatatgatatacgtctggacgacctgactgcggacgggcggcttgggccctcg
gcccagttgatgaacgacgctggcagacacaacgcgaacgaaggatag

  All links  
No link information was found.   
DBGET integrated database retrieval system