KEGG   Octadecabacter antarcticus: OAN307_c09600Help
Entry
OAN307_c09600     CDS       T02538                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme GlgB (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
oat  Octadecabacter antarcticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:oat00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(946017..948215)
Genome map
AA seq 732 aa AA seqDB search
MINDDDAQKISTGSHPDPFSVLGQHIVDTKVTHRAYHPNADAVNVVDTKTGRTIASLGRA
SNAHGLFAGTAPRRKNPFAYRLKFTKGDHTWEAEDPYRFGPVLGELDEHLITEGAHLDLW
KVLGAHVMDHEGVAGTHFAVWAPNAQRVSVVGDFNGWDGRRNPMRGRGQTGVWEIFMPGL
GDGEVYKYELIGAHGELLPQKADPFGFGSEHPPKTASVVRKLDGHTWADRKWMGKRAALQ
RIDQPISIYEVHLGSWKRVPEEGNRPLSYFEHATQLVSYAKDMGFTHLELMPISEFPFDG
SWGYQPVGLYAPTIRHGTLEEFRAFVEACHAADLGLILDWVPGHFPEDKHGLGQFDGTPL
YEHADRKEGFHPDWNTLVYNYGRAEVSNYLVANALYWLKEHHIDGLRVDAVASMLYRDYS
RKDGEWVPNKDGGRENLEAIAFLQRTNTVAYGSTTGIVTIAEESTAFPGVSAPVDHDGLG
FGFKWNMGWMNDSLSYIQEDPINRKYHHHKMTFALHYAFTENFVLPISHDEVVHGKGSMI
EKMPGEGDEKFANLRAYYGYMWGHPGKKLLFMGCEFAQGVEWNHDESLNWHLTEHPQHGG
VQNLVRDLNMLFRDTPALHQLDCKPEGFEWIEEGSAEESIFAWLRHGTKGTAPVLVVSNF
TPVERSARRIGVPLAGRWIERLNSDAARYGGGDRGNMGFADSKQIASSGRANSVSLIIPP
LSTLFFELEETS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaatgacgacgacgcgcaaaagatttcaacaggcagtcatcccgatccgttttcg
gtgcttgggcaacacatagttgatacaaaagtcacccatcgagcctaccaccccaacgcc
gacgcggttaatgttgtcgatactaagactggtcgaaccattgcgtcactgggccgcgcc
tcgaacgcacatggcctgtttgcgggaacagcaccacgtcgcaaaaacccgtttgcctac
cgtctaaagttcaccaaaggcgaccatacgtgggaggccgaagacccctatcggttcggc
cccgttttgggtgaattggatgaacatctgatcaccgaaggcgcacatcttgatttgtgg
aaagtccttggtgcccatgtgatggatcatgaaggtgtcgcaggaacgcattttgcggtc
tgggccccgaacgcacagcgcgtgtctgtcgttggtgatttcaacggctgggacgggcgg
cgcaacccgatgcgcgggcgcggccaaactggcgtctgggagatttttatgcccggtttg
ggcgacggtgaagtgtataaatatgaactcatcggcgcgcacggcgaactgctgccacaa
aaggcggacccgtttggatttgggtcagaacacccgcccaaaaccgcttccgttgtgcgt
aaattggacggacacacatgggctgaccgcaagtggatgggcaagcgcgcggcgctacag
cgcatcgaccagccaatttccatctacgaagtgcatctgggatcatggaagcgcgtcccc
gaagagggcaatcgtccgctgtcttactttgagcacgcaacgcaactggtcagctatgcc
aaagacatgggatttacccaccttgaactgatgccgatttcggaattcccgtttgacggg
tcttggggctaccaacctgtcgggctttacgcgccgacaatccggcatggcacgctagaa
gaattccgcgcctttgtcgaagcctgccacgcggccgacctaggcctgatccttgattgg
gtgcccggacatttccccgaagacaagcacgggttgggccagtttgacggaacgccactg
tacgagcacgccgaccgcaaagaaggctttcatccggattggaacacgctggtctacaac
tatggtcgcgctgaagtgtccaactaccttgttgccaacgcgttgtattggctaaaggaa
caccacatcgacgggctgcgtgtcgatgctgtggcgtcgatgctgtaccgtgattattca
cgcaaagacggtgaatgggttcccaacaaggatggcggacgcgagaacctcgaagcgatt
gcgttcctgcagcgcaccaacaccgtggcctacggatcgacgacgggcattgtcacaatc
gccgaagaatccaccgcctttccgggggtgagcgcacctgttgatcacgacggccttggc
tttgggttcaaatggaacatgggctggatgaacgactcgctgtcctacatccaagaagac
ccgatcaaccgcaaataccatcaccacaagatgacgttcgcgctgcactacgcgtttacc
gagaatttcgttctgccgatcagccacgacgaagtggtgcacggcaagggatcgatgatc
gaaaaaatgcccggtgagggggacgaaaagtttgccaacctgcgcgcctactacggctat
atgtggggccacccgggcaagaaactgttgtttatgggctgcgaatttgcgcaaggtgta
gaatggaaccacgacgaaagcctcaattggcatctgaccgaacacccgcagcacggcggt
gttcaaaaccttgtgcgcgacctgaacatgctgttccgtgacacccccgccctgcaccag
cttgattgcaagcccgaagggtttgaatggatcgaagaaggttccgccgaagaatccatt
tttgcatggttgcgccacggaaccaaaggcacggcacctgtgctggtcgtcagcaacttt
acacctgttgaacgatccgcgcgccgcattggtgtgccgctggccggacgctggattgaa
agattgaattccgacgctgcacgctatggcggcggcgaccgcggcaacatgggatttgcc
gacagcaaacagattgcatcgtctgggagggcgaattctgtctcgctcataataccaccg
ctttcgacgctgttttttgaactggaagaaacgtcctga

DBGET integrated database retrieval system