KEGG   Octadecabacter antarcticus: OAN307_c09810Help
Entry
OAN307_c09810     CDS       T02538                                 

Definition
(GenBank) metal dependent peptidase
Organism
oat  Octadecabacter antarcticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(975594..976634)
Genome map
AA seq 346 aa AA seqDB search
MSKMNTELLRQLCEIPGVPGHEDRVRDLIMGEIEGLFDEVTVDPMGSLLCRRDAEKPNAP
KIMLLCHMDEIGFLVCHISDKGYLYLQPVGGFDPRNLFSRRVLVCTDDGDFKGVMNPSGK
PIHISSAEDRKKIPEVGEFYVDLGMGEASKDVVKVGDYVVMDEPFIEIGDKFVSKALDNR
IACWLGIEMMRKLGSKGRGSEIHVVFTTQEEVGLRGARTSAFKVQPDIGIGIDTTLACDT
PGVPDKDATTIQGRGFGLHVRDSSFIADKALVREIEALAIKNSIPYQRTMLAAGGQDGAA
AQQAAAGARAVGIVVGTRYIHTVTEMIHKTDLQAALDILTAYLADQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatgaacaccgaactgctgcgccaactttgtgaaattccaggtgttccaggc
catgaggatcgcgtgcgcgacctgatcatgggtgaaattgaggggctgtttgatgaggta
acagtcgatccgatggggtcacttttgtgtcgccgtgacgccgaaaaaccgaacgcgcca
aagatcatgttgttgtgtcacatggacgaaatcggctttctggtctgccatatcagcgac
aaaggatatctgtatctgcagcccgtcggcggctttgatccgcgcaatctgttctcgcgc
cgtgtgctggtctgcaccgacgatggggattttaagggcgtgatgaacccgagtggcaaa
ccaattcacatttcatcggctgaggatcgcaagaaaattcccgaagtcggggaattctac
gttgatctcggcatgggtgaagcctccaaagacgttgtgaaggtcggtgattatgtggtg
atggacgaaccatttattgaaattggcgataaatttgtatccaaggcgttagacaatcgc
atcgcgtgttggttgggcatcgagatgatgagaaagcttggctccaaagggcgtggctcg
gaaatccatgtggtgttcacgacgcaagaagaagtgggattgcggggggccagaacgtcc
gcgtttaaggtccagccagacatcggaattggcatcgacaccacgctggcttgtgacacc
cccggtgtgcccgacaaggacgcgacgaccattcaaggccgcggctttgggctgcacgta
cgtgacagcagcttcatcgcggacaaggcattggtgcgcgagattgaagcactcgcgatc
aagaatagcatcccctatcagcgcacaatgctggcggcgggtggccaggacggggccgct
gcacagcaggcagccgccggtgcgcgtgccgtcggaattgtcgtcgggacgcgctatatt
cataccgtcacagagatgatccataaaaccgatttgcaggcggcgctggacattttgacg
gcgtatctggccgatcaatga

DBGET integrated database retrieval system